Align 2-hydroxy-3-oxopropionate reductase; EC 1.1.1.60; Tartronate semialdehyde reductase; TSAR (uncharacterized)
to candidate HSERO_RS10090 HSERO_RS10090 oxidoreductase
Query= curated2:P77161 (292 letters) >FitnessBrowser__HerbieS:HSERO_RS10090 Length = 282 Score = 102 bits (255), Expect = 8e-27 Identities = 80/275 (29%), Positives = 129/275 (46%), Gaps = 4/275 (1%) Query: 11 MGTPMAINLARAGHQLHVTTIGPV-ADELLSLGAVSVETARQVTEASDIIFIMVPDTPQV 69 MG PMA NL RAG+ + P + L +LGA + T + +D++ M+ D Sbjct: 1 MGFPMAANLVRAGYAVRAWNRSPAPVERLAALGAQAAATPAEAAADADVLISMLADDDAT 60 Query: 70 EEVLFGENGCTKASLKGKTIVDMSSISPIETKRFARQVNELGGDYLDAPVSGGEIGAREG 129 E L + G A G V+M++IS R A G Y+ APV G A G Sbjct: 61 ETSLL-DAGALAALRPGAIHVNMATISVALALRLAGLHQARGVAYVAAPVLGRVNVAEAG 119 Query: 130 TLSIMVGGDEAVFERVKPLFELLGKNITLVGGNGD-GQTCKVANQIIVALNIEAVSEALL 188 L+I+ G+E V+PL ++LG+ +G + K+A ++A I A+SEA+ Sbjct: 120 QLNILAAGEEQALAAVQPLLDVLGQKTWRLGRQPEQANAAKLAMNFMIASAIGAMSEAVA 179 Query: 189 FASKAGADPVRVRQALMGGFASSRILEVHGERMIKRTFNP-GFKIALHQKDLNLALQSAK 247 G D + ++ + + +G+ + F P GFK+AL KD+ LAL++ + Sbjct: 180 LVQGYGLDKAGFIELATSTAFAAPVYKGYGQAIADDRFEPAGFKLALGLKDVRLALEAGE 239 Query: 248 ALALNLPNTATCQELFNTCAANGGSQLDHSALVQA 282 + L + ++L A+G LD +AL +A Sbjct: 240 QAHVPLSLASALRDLHIDGLAHGEGHLDWAALSRA 274 Lambda K H 0.318 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 282 Length adjustment: 26 Effective length of query: 266 Effective length of database: 256 Effective search space: 68096 Effective search space used: 68096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory