Align ABC transporter for L-asparagine and L-glutamate, permease component 1 (characterized)
to candidate HSERO_RS19250 HSERO_RS19250 glutamate ABC transporter permease
Query= reanno::pseudo1_N1B4:Pf1N1B4_772 (248 letters) >FitnessBrowser__HerbieS:HSERO_RS19250 Length = 249 Score = 237 bits (605), Expect = 1e-67 Identities = 125/246 (50%), Positives = 166/246 (67%), Gaps = 4/246 (1%) Query: 1 MNYNWDWGVFFKSTGVGSEIYFDWYLSGLGWTIAIAVAAWIIALLLGSILGVMRTVPNRI 60 M+YNW+WG+F++ + G Y D L+GL WT+A A AWI+AL+LG+I G +RT Sbjct: 1 MHYNWNWGIFWEMSPDGIP-YIDTLLAGLKWTLATAACAWIMALILGTIFGTLRTTTKPW 59 Query: 61 VSGIATCYVELFRNVPLLVQLFIWYFLVPDLLPADIQEWYKQDLNPTTSAFLSVVVCLGL 120 V IA YVELFRN+PLLVQ+F+WYF++P+LLPA I +W K + ++F++ + LG Sbjct: 60 VVRIANGYVELFRNIPLLVQMFLWYFVMPELLPAFIGDWIK---SLPDASFVTATLALGF 116 Query: 121 FTTARVCEQVRTGIQALPRGQEAAARAMGFKLPQIYWNVLLPQAYRIIIPPLTSEFLNVF 180 FT++RV QV TGIQALPRGQ A A+G Q Y VLLP A+RIIIP LT+EF + Sbjct: 117 FTSSRVAVQVTTGIQALPRGQRMAGAALGLTPVQTYRYVLLPMAFRIIIPALTNEFAAII 176 Query: 181 KNSSVASLIGLMELLAQTKQTAEFSANLFEAFTLATLIYFTLNMSLMLLMRSVEKKVAVP 240 KNSSVA IGL+EL A T EF+ FEA T AT+IY +++ + + R +EK AVP Sbjct: 177 KNSSVALTIGLVELTAATYSMREFTFQTFEALTGATIIYVIISVIALFMARLLEKVTAVP 236 Query: 241 GLISVG 246 G I+ G Sbjct: 237 GYITGG 242 Lambda K H 0.326 0.140 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 249 Length adjustment: 24 Effective length of query: 224 Effective length of database: 225 Effective search space: 50400 Effective search space used: 50400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory