GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gltP in Herbaspirillum seropedicae SmR1

Align Proton/sodium-glutamate symport protein; Glutamate-aspartate carrier protein (characterized)
to candidate HSERO_RS19090 HSERO_RS19090 C4-dicarboxylate ABC transporter

Query= SwissProt::P24943
         (421 letters)



>lcl|FitnessBrowser__HerbieS:HSERO_RS19090 HSERO_RS19090
           C4-dicarboxylate ABC transporter
          Length = 431

 Score =  327 bits (837), Expect = 6e-94
 Identities = 174/428 (40%), Positives = 278/428 (64%), Gaps = 15/428 (3%)

Query: 2   RKIGLAWQIFIGLILGIIVGAIFYGN------PKVATYLQPIGDIFLRLIKMIVIPIVIS 55
           ++I  A  IF  ++LGI+VG + + +       ++A Y+    D+FLRLIKM++ P+V S
Sbjct: 3   KRIPQAAYIFAAMLLGILVGYLIFSHNDKAQAKELAGYISIASDLFLRLIKMVIAPLVFS 62

Query: 56  SLVVGVASVGDLKKLGKLGGKTIIYFEIITTIAIVVGLLAANIFQPGTGVNMKSLEKTDI 115
           +LVVG+A +GD K +G++ GK++ +F I + +++ +G++ AN+ QPG GV   +L   D 
Sbjct: 63  TLVVGIAHMGDAKSVGRIFGKSLAWFFIASLVSLALGMIMANLLQPGAGV---ALPSPDA 119

Query: 116 QSYVDTTNEVQHHSMVETFVNIVPKNIFESLTKGDMLPIIFFSVMFGLGVAAIGEKGKPV 175
                 T++    ++ E F ++VPK+I E++ + ++L ++ FS+ FG+ +A++GE+GK +
Sbjct: 120 AGAGLATSKF---TVKEFFNHLVPKSIVEAMAQNEVLQVVVFSMFFGIALASLGERGKHL 176

Query: 176 LQFFQGTAEAMFYVTNQIMKFAPFGVFALIGVTVSKFGVESLIPLSKLVIVVYATMVFFI 235
           L      +  M  +T  +MKFAP  VFA +  TV+  G+E L+  +  +   Y ++V  +
Sbjct: 177 LAVIDDLSHTMLKITVYVMKFAPVAVFAAMAATVAVNGLEILVSFAVFMRDFYFSLVL-L 235

Query: 236 FVVLGGVAKLF-GINIFHIIKILKDELILAYSTASSETVLPKIMEKMENFGCPKAITSFV 294
           +V+L  V  +F    IFH++ ++K+  +LA++TASSE   PK+++ ++ FG  + I+SFV
Sbjct: 236 WVILIAVGFIFLKKRIFHLLALIKEAFLLAFATASSEAAYPKLLDALDRFGVKRKISSFV 295

Query: 295 IPTGYSFNLDGSTLYQALAAIFIAQLYGIDMPISQQISLLLVLMVTSKGIAGVPGVSFVV 354
           +P GYSFNLDGS +Y   A +FIAQ YGI MPIS QI+++LVLM+TSKGIAGVP  S VV
Sbjct: 296 MPMGYSFNLDGSMIYCTFATLFIAQAYGIHMPISTQITMMLVLMLTSKGIAGVPRASLVV 355

Query: 355 LLATLGTVGIPIEGLAFIAGIDRILDMARTAVNVIGNSLAAIIMSKWE-GQYNEEKGKQY 413
           + ATL    IP  GL  I GID  LDM R+A N +GNS+A+ +++KWE G   EE+  + 
Sbjct: 356 IAATLHQFNIPEAGLLVILGIDTFLDMGRSATNAVGNSIASAVVAKWEGGLMTEEEAARA 415

Query: 414 IAQLQQSA 421
             +++Q A
Sbjct: 416 EVEIEQEA 423


Lambda     K      H
   0.326    0.143    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 415
Number of extensions: 14
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 421
Length of database: 431
Length adjustment: 32
Effective length of query: 389
Effective length of database: 399
Effective search space:   155211
Effective search space used:   155211
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory