GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gltP in Herbaspirillum seropedicae SmR1

Align Proton/glutamate-aspartate symporter; Glutamate-aspartate carrier protein; Proton-glutamate-aspartate transport protein (characterized)
to candidate HSERO_RS22690 HSERO_RS22690 C4-dicarboxylate ABC transporter

Query= SwissProt::P21345
         (437 letters)



>lcl|FitnessBrowser__HerbieS:HSERO_RS22690 HSERO_RS22690
           C4-dicarboxylate ABC transporter
          Length = 444

 Score =  301 bits (770), Expect = 4e-86
 Identities = 173/419 (41%), Positives = 252/419 (60%), Gaps = 14/419 (3%)

Query: 7   SLAWQILFAMVLGILLGSYLHYHSDSRDWLVVNLLSPAGDIFIHLIKMIVVPIVISTLVV 66
           SL  Q++ A++ GI++G +      +        L P GD FI LIKMI+  IV   +V 
Sbjct: 7   SLFGQVVLALIGGIIIGLFWPDFGQN--------LKPLGDGFIKLIKMIIPVIVFCVVVQ 58

Query: 67  GIAGVGDAKQLGRIGAKTIIYFEVITTVAIILGITLANVFQPGAG--VDMSQLATVDISK 124
           GI G  D K++G +G K IIYFEV+TT+A++LG+ LA V QPGAG  +D S L    +S 
Sbjct: 59  GICGASDLKKVGSVGVKAIIYFEVVTTIALLLGLVLALVVQPGAGMNIDPSNLDASSLSG 118

Query: 125 YQSTTEAVQSSSHGIMGTILSLVPTNIVASMAKGEMLPIIFFSVLFGLGLSSLPATHREP 184
           Y +    V+ +  G    I+ L+P   V++   G++L ++  SV FG  L  L      P
Sbjct: 119 YMANAGKVKET--GFAEFIMKLIPATAVSAFTSGDVLQVLLISVTFGCALL-LIGEKGAP 175

Query: 185 LVTVFRSISETMFKVTHMVMRYAPVGVFALIAVTVANFGFSSLWPLAKLVLLVHFAILFF 244
           +V +  S+S+  FK     +R AP+GV   IA TV  +G  SL  LA LVLL + A++FF
Sbjct: 176 VVALVASLSDAFFKCMSFFIRLAPLGVLGAIAFTVGKYGIGSLKQLALLVLLFYGAVIFF 235

Query: 245 ALVVLGIVARLCGLSVWILIRILKDELILAYSTASSESVLPRIIEKMEAYGAPVSITSFV 304
            LVVLG + R  GLS++ LIR L++EL++  +T SS+SVLP+I++K+E  G   S    V
Sbjct: 236 VLVVLGGILRASGLSIFKLIRYLREELVVVLATTSSDSVLPQIMKKLEHMGIKKSTVGLV 295

Query: 305 VPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSIWQEIILVLTLMVTSKGIAGVPGVSFVV 364
           +PTGYSFNLD  ++Y ++AA+FIAQ     LS+     ++   +VTSKG  GVPG + V+
Sbjct: 296 IPTGYSFNLDAFSIYLTMAALFIAQATNTHLSMGDLAAILAIALVTSKGAHGVPGSAIVI 355

Query: 365 LLATLGSV-GIPLEGLAFIAGVDRILDMARTALNVVGNALAVLVIAKWEHKFDRKKALA 422
           L ATL ++  IP+ GL  +  +D  + +AR   N++GN +A +VIA WE   D+ +A A
Sbjct: 356 LAATLTTIPAIPVVGLVLVLSIDWFIGIARALGNLLGNCVATVVIASWERDIDKVRARA 414


Lambda     K      H
   0.326    0.141    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 497
Number of extensions: 23
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 437
Length of database: 444
Length adjustment: 32
Effective length of query: 405
Effective length of database: 412
Effective search space:   166860
Effective search space used:   166860
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory