Align Proton/glutamate-aspartate symporter; Glutamate-aspartate carrier protein; Proton-glutamate-aspartate transport protein (characterized)
to candidate HSERO_RS22690 HSERO_RS22690 C4-dicarboxylate ABC transporter
Query= SwissProt::P21345 (437 letters) >FitnessBrowser__HerbieS:HSERO_RS22690 Length = 444 Score = 301 bits (770), Expect = 4e-86 Identities = 173/419 (41%), Positives = 252/419 (60%), Gaps = 14/419 (3%) Query: 7 SLAWQILFAMVLGILLGSYLHYHSDSRDWLVVNLLSPAGDIFIHLIKMIVVPIVISTLVV 66 SL Q++ A++ GI++G + + L P GD FI LIKMI+ IV +V Sbjct: 7 SLFGQVVLALIGGIIIGLFWPDFGQN--------LKPLGDGFIKLIKMIIPVIVFCVVVQ 58 Query: 67 GIAGVGDAKQLGRIGAKTIIYFEVITTVAIILGITLANVFQPGAG--VDMSQLATVDISK 124 GI G D K++G +G K IIYFEV+TT+A++LG+ LA V QPGAG +D S L +S Sbjct: 59 GICGASDLKKVGSVGVKAIIYFEVVTTIALLLGLVLALVVQPGAGMNIDPSNLDASSLSG 118 Query: 125 YQSTTEAVQSSSHGIMGTILSLVPTNIVASMAKGEMLPIIFFSVLFGLGLSSLPATHREP 184 Y + V+ + G I+ L+P V++ G++L ++ SV FG L L P Sbjct: 119 YMANAGKVKET--GFAEFIMKLIPATAVSAFTSGDVLQVLLISVTFGCALL-LIGEKGAP 175 Query: 185 LVTVFRSISETMFKVTHMVMRYAPVGVFALIAVTVANFGFSSLWPLAKLVLLVHFAILFF 244 +V + S+S+ FK +R AP+GV IA TV +G SL LA LVLL + A++FF Sbjct: 176 VVALVASLSDAFFKCMSFFIRLAPLGVLGAIAFTVGKYGIGSLKQLALLVLLFYGAVIFF 235 Query: 245 ALVVLGIVARLCGLSVWILIRILKDELILAYSTASSESVLPRIIEKMEAYGAPVSITSFV 304 LVVLG + R GLS++ LIR L++EL++ +T SS+SVLP+I++K+E G S V Sbjct: 236 VLVVLGGILRASGLSIFKLIRYLREELVVVLATTSSDSVLPQIMKKLEHMGIKKSTVGLV 295 Query: 305 VPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSIWQEIILVLTLMVTSKGIAGVPGVSFVV 364 +PTGYSFNLD ++Y ++AA+FIAQ LS+ ++ +VTSKG GVPG + V+ Sbjct: 296 IPTGYSFNLDAFSIYLTMAALFIAQATNTHLSMGDLAAILAIALVTSKGAHGVPGSAIVI 355 Query: 365 LLATLGSV-GIPLEGLAFIAGVDRILDMARTALNVVGNALAVLVIAKWEHKFDRKKALA 422 L ATL ++ IP+ GL + +D + +AR N++GN +A +VIA WE D+ +A A Sbjct: 356 LAATLTTIPAIPVVGLVLVLSIDWFIGIARALGNLLGNCVATVVIASWERDIDKVRARA 414 Lambda K H 0.326 0.141 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 497 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 437 Length of database: 444 Length adjustment: 32 Effective length of query: 405 Effective length of database: 412 Effective search space: 166860 Effective search space used: 166860 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory