Align major cell-binding factor (characterized)
to candidate HSERO_RS10775 HSERO_RS10775 cysteine ABC transporter substrate-binding protein
Query= CharProtDB::CH_021449 (259 letters) >FitnessBrowser__HerbieS:HSERO_RS10775 Length = 267 Score = 107 bits (266), Expect = 3e-28 Identities = 82/251 (32%), Positives = 132/251 (52%), Gaps = 21/251 (8%) Query: 17 ACVAFSNANAAEGKLESIKSKGQLIVGVKNDVPHYALLDQATGEIKGFEVDVAKLLAKSI 76 A +A S + +A L+S+KS G L V ++ + P + D TGE+ GFEVDVAKLLA + Sbjct: 16 ALLASSLSVSAADLLQSVKSSGTLKVALEGNYPPFNFKDPKTGELTGFEVDVAKLLAAKL 75 Query: 77 LGDDKKIKLVAVNAKTRGPL--LDNGSVDAVIATFTITPERKRIYNFSEPYYQDAIGLLV 134 +K V + G L L G D +I IT ER++ ++FS+PY + L+V Sbjct: 76 -----GVKPVFTTTEWSGILAGLGAGKYDVIINQVGITDERQKAFDFSDPYTLSSAQLIV 130 Query: 135 LKEKK--YKSLADMKGANIGVAQAATTKKAIGEAAKKIGIDVKFSEFPDYPSIKAALDAK 192 K++K +KSL D+KG +G+ Q ++ +A GIDV+ +P P A L A Sbjct: 131 RKDEKREFKSLEDLKGKKLGLGQGTNFEQ---KAKAVPGIDVR--TYPGSPEYLADLAAG 185 Query: 193 RVDAFSVDKSILLGYVDDKSEILPDSFEP----QSYGIVTKKDDPAFAKYVDDFVKEHK- 247 R+DA +++ S+L+GY+ + + + P GI +K +P F ++ + + K Sbjct: 186 RIDA-ALNDSLLVGYILKSTNLPLKAGSPIGAVDKIGIPFRKGNPEFKAALNKALADIKA 244 Query: 248 -NEIDALAKKW 257 A ++KW Sbjct: 245 DGSFKAASEKW 255 Lambda K H 0.316 0.135 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 267 Length adjustment: 25 Effective length of query: 234 Effective length of database: 242 Effective search space: 56628 Effective search space used: 56628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory