Align alcohol dehydrogenase (EC 1.1.1.1); long-chain-alcohol dehydrogenase (EC 1.1.1.192) (characterized)
to candidate HSERO_RS00730 HSERO_RS00730 4-hydroxybutyrate dehydrogenase
Query= BRENDA::A4IP64 (395 letters) >FitnessBrowser__HerbieS:HSERO_RS00730 Length = 379 Score = 181 bits (459), Expect = 3e-50 Identities = 120/351 (34%), Positives = 192/351 (54%), Gaps = 17/351 (4%) Query: 16 WGALDQLVPEVKRLGAKHILVITDPMLVKIGLVDQVTSPLRQEGYSVHVYTDVVPEPPLE 75 +GAL L E RLG K LV+TD + GL+D+V L+ EG VY P P Sbjct: 14 YGALALLQQECDRLGIKKPLVVTDMGIRNAGLLDKVLGQLK-EGVGAVVYDQTPPNPNEG 72 Query: 76 TGEKAVAFARDGKFDLVIGVGGGSALDLAKLAAVLAVHDGSVADYLNLTG-TRTLEKKGL 134 AVA R D ++ VGGGS++DLAK AV H+G + + + G + K Sbjct: 73 AVRAAVALFRQHGCDGIVAVGGGSSIDLAKGVAVCGTHEGPLKSFALIEGGLANITAKTA 132 Query: 135 PKILIPTTSGTGSEVTNISVLSLETTKDV-VTHDYLLADVAIVDPQLTVSVPPRVTAATG 193 P I IPTT+GTGSEV ++L L+ + V + YL+ +AI DP+LT+ +PP +TAATG Sbjct: 133 PVIAIPTTAGTGSEVGRGAILILDDGRKVGIISPYLVPKLAICDPELTLGLPPLMTAATG 192 Query: 194 IDALTHAVEAYVSVNASPTSDGLAVAAIRLISRSLRKAVANGSDKQARIDMANGSYLAGL 253 +DA+ H +E +++ + +P +DG+A+ + + +A D++AR++M + S + G Sbjct: 193 MDAIAHCLETFMAPSFNPPADGIALDGLWRAWAHIERATREPGDREARLNMMSAS-MQGA 251 Query: 254 AFFNAGVAGVHALAYPLGG-QFHIAHGESNAVLLPYVMGYIRQSCT----KRMADIFNAL 308 F G+ VH+L++ LGG + HG NA+ LP ++ + + + +MA + +A+ Sbjct: 252 MAFQKGLGCVHSLSHSLGGINPRLHHGTLNAIFLPAIIAFNESAASMVKDNKMARMAHAM 311 Query: 309 GGNSSFLSEVEASYRCVEELERFVADVGIPKTLGGFGIPESALESLTKDAV 359 G S +E+ + R E+ R +G+P LG G+ ES + + A+ Sbjct: 312 GLGSG--AEIGPAIR---EMSR---RLGLPAGLGELGVTESMFPQIIQGAL 354 Lambda K H 0.318 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 379 Length adjustment: 30 Effective length of query: 365 Effective length of database: 349 Effective search space: 127385 Effective search space used: 127385 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory