Align NAD-dependent glycerol dehydrogenase; Dha-forming NAD-dependent glycerol dehydrogenase; EC 1.1.1.6 (characterized)
to candidate HSERO_RS05340 HSERO_RS05340 short-chain dehydrogenase
Query= SwissProt::Q92EU6 (254 letters) >FitnessBrowser__HerbieS:HSERO_RS05340 Length = 241 Score = 135 bits (339), Expect = 1e-36 Identities = 81/239 (33%), Positives = 128/239 (53%), Gaps = 8/239 (3%) Query: 15 KVAVVTGAASGIGKAMAELFSEKGAYVVLLDIKEDVKDVAAQINPSRTLALQVDITKKEN 74 K ++TGA GIG+A A L +++GA V+ L D+A + VD++ Sbjct: 6 KTVIITGAGRGIGRACALLLAQRGAQVIAL--ARTASDLARLQEEIGARVIAVDLSDPAA 63 Query: 75 IEKVVAEIKKVYPKIDILANSAGVALLEKAEDLPEEYWDKTMELNLKGSFLMAQIIGREM 134 + +AE D L NSAG+ +LE ++ +E ++ + +NL+ + + Q R Sbjct: 64 ARRAMAEAGTA----DFLINSAGINVLESVLEMSDEGYEAVLGVNLRAALITCQAFARMR 119 Query: 135 IATGGG-KIVNMASQASVIALDKHVAYCASKAAIVSMTQVLAMEWAPYNINVNAISPTVI 193 IA GGG +VN+ S A ++H+ Y ASKA + T+VLA E P+ I VNA++PT+ Sbjct: 120 IAQGGGGAMVNITSIAGHRGFEQHLCYAASKAGLEGATRVLARELGPHGIRVNAVAPTIT 179 Query: 194 LTELGKKAWAGQV-GEDMKKLIPAGRFGYPEEVAACALFLVSDAASLITGENLIIDGGY 251 LTEL + AW+ M P+ RF PE+VA L+S A+++ G + +DGG+ Sbjct: 180 LTELAEAAWSDPAKSGPMMARHPSARFASPEDVARSIAMLLSPDAAMLNGAVVPVDGGF 238 Lambda K H 0.316 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 241 Length adjustment: 24 Effective length of query: 230 Effective length of database: 217 Effective search space: 49910 Effective search space used: 49910 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory