Align Alpha-glycerophosphate oxidase; EC 1.1.3.21; Exported protein 6; Glycerol-3-phosphate oxidase (uncharacterized)
to candidate HSERO_RS23645 HSERO_RS23645 glycerol-3-phosphate dehydrogenase
Query= curated2:P35596 (608 letters) >FitnessBrowser__HerbieS:HSERO_RS23645 Length = 534 Score = 169 bits (427), Expect = 4e-46 Identities = 157/566 (27%), Positives = 245/566 (43%), Gaps = 77/566 (13%) Query: 21 DLLIIGGGITGAGVALQAAASGLETGLIEMQDFAEGTSSRSTKLVHGGLRYLKQFDVEVV 80 D+L++GGGI GAG+A AA GL L E D A+ TSS S+KL+HGGLRYL+ ++ +V Sbjct: 16 DVLVVGGGINGAGIARDAAGRGLSVALCEQHDLAQHTSSSSSKLIHGGLRYLEHYEFGLV 75 Query: 81 SDTVSERAVVQQIAPHIPKSDPMLLPVYDEDGATFSLFRLKVAMDLYDLLAGVSNTPAAN 140 + ER V+ + APHI ++P D + +++ M LYD LA P + Sbjct: 76 RKALIEREVLLRSAPHIMWPLRFVMP---HDQGQRPAWLIRLGMFLYDHLARRELLP-GS 131 Query: 141 KVLSKDQVLERQPNLKKEGLVGGGVYLDFRNNDARLVIENIKRANQDGALIANHVKAEGF 200 + L + P K G VY D +DARLV+ N A + GA I + E Sbjct: 132 RALDLRRHASGAP--LKAQFTRGFVYSDGWVDDARLVVLNAMDAAEKGAHIMTRTRCESL 189 Query: 201 LFDESGKITGVVARDLLTDQVFEIKARLVINTTGPWSDKVRNLSNKGTQFSQMRPTKGVH 260 ++G V+ R+ +++AR V+N GPW + + +R KG H Sbjct: 190 TRQDNG-WQAVLRRE--DGHAMQVRARCVVNAAGPWVAQFLGGAAHVHSSKSVRLVKGSH 246 Query: 261 LVVDSSKIKVSQPVYFDTGLGDGRMVFVLPRENK-TYFGTTDTDYTGDLEHPKVTQEDVD 319 +VV ++ Y DGR+VF +P E T GTTD +Y G +E ++ ++ Sbjct: 247 IVV--PRLFEHDHAYIFQN-PDGRIVFAIPYEQDFTLIGTTDIEYQGRVEDVAISADETA 303 Query: 320 YLLGIVNNRFPESNITIDDIESSWAGLRPLIAGNSASDYNGGNNGTISDESFDNLIATVE 379 YL + NR+ E IT DD+ S++G+RPL+ +A Sbjct: 304 YLCQLA-NRYFEKPITPDDVVWSYSGVRPLLEDAAA------------------------ 338 Query: 380 SYLSKEKTREDVESAVSKLESSTSEKHLDPSAVSRGSSLDRDDNG--LLTLAGGKITDYR 437 D SAV+R LD + G LL++ GGKIT +R Sbjct: 339 ----------------------------DASAVTRDYQLDLNLQGAPLLSIFGGKITTFR 370 Query: 438 KMAEGAMERVVDIL---KAEFDRSFKLINSKTYPVSGGELNPANVDSEIEAFAQLGVSRG 494 K+AE A++ + +L + + L Y + D ++ Q Sbjct: 371 KLAEEAVDMIAPVLGNQRGAWTEHGCLPGGDLYGAQPSNRSVRQFDQYVQGLQQ--QYPW 428 Query: 495 LDSKEAHYLANLYGSNAPKVFALAHSLEQAPGLSLADTL---SLHYAMRNELTLSPVDFL 551 L + A YGS + ++E+ G + D L + Y +R+E + D L Sbjct: 429 LPAALLQRYARAYGSRTHTLLEGRQNVEEM-GEEILDGLYAAEVDYLLRHEWASNAADIL 487 Query: 552 LRRTNHMLFMRDSLDSIVEPILDEMG 577 RR+ L +++++ L G Sbjct: 488 WRRSKLGLHFPKGSEAVLDAWLAARG 513 Lambda K H 0.314 0.133 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 627 Number of extensions: 39 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 608 Length of database: 534 Length adjustment: 36 Effective length of query: 572 Effective length of database: 498 Effective search space: 284856 Effective search space used: 284856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory