Align Polar amino acid ABC transporter, inner membrane subunit; Flags: Precursor (characterized, see rationale)
to candidate HSERO_RS05830 HSERO_RS05830 amino acid ABC transporter permease
Query= uniprot:B2TBJ7 (240 letters) >FitnessBrowser__HerbieS:HSERO_RS05830 Length = 218 Score = 123 bits (309), Expect = 3e-33 Identities = 72/215 (33%), Positives = 119/215 (55%), Gaps = 17/215 (7%) Query: 1 MALIQMLGFGPEGWGGVLLLAALMTVALTLAALAVGAVFGALVAAAKLSRFRTLRVIGDI 60 M L +L F P +LL AL+TV +T+ + + +V G L+A K+SR + + + G Sbjct: 1 MLLQNVLDFLP-----ILLKGALVTVEVTIYSFLLSSVIGLLLALMKVSRLKPVALAGAT 55 Query: 61 YTTVFRGVPELLVIYLFYFGGSTLVTSVGQLFGAEGFVGVPPFVVGALAVGMISGAYQAE 120 + RG+P ++ ++ YF ++ +G + + F G + +G+ AYQAE Sbjct: 56 IVNIIRGLPIIVQLFYIYF----VLPDIG--------IQLSAFQAGVVGLGIAYSAYQAE 103 Query: 121 VYRSAVLAVSRGELEAARSIGMPTLTMARRILIPQVLRFALPGIGNVWQLSLKDSALISV 180 +R+ + AV G++EAA+SIGM + RR+++PQ R ALP GN + LKDS+L+S Sbjct: 104 NFRAGIEAVDMGQIEAAQSIGMRGPLIMRRVVLPQAFRIALPPYGNTLVMMLKDSSLVST 163 Query: 181 TGLAELLRTSQVAAGSTHQYFTFFVVGGALYLIMT 215 + E+ R Q+ A ST Q T + LYL+++ Sbjct: 164 ITVLEMTRAGQMIASSTFQNMTVYTTVAVLYLLLS 198 Lambda K H 0.327 0.141 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 107 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 218 Length adjustment: 23 Effective length of query: 217 Effective length of database: 195 Effective search space: 42315 Effective search space used: 42315 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory