Align Polar amino acid ABC transporter, inner membrane subunit (characterized, see rationale)
to candidate HSERO_RS11445 HSERO_RS11445 ABC transporter permease
Query= uniprot:B2TBJ8 (250 letters) >FitnessBrowser__HerbieS:HSERO_RS11445 Length = 221 Score = 124 bits (311), Expect = 2e-33 Identities = 72/221 (32%), Positives = 124/221 (56%), Gaps = 10/221 (4%) Query: 1 MHFDFDFLFDTIKQLLAAVPTTLGLFFCSLILGGLLSLVIVTMRVSPHW-LPNRFARAYI 59 M DF ++++ L+ T+ + SL++G +L L++ R+SP + Y+ Sbjct: 1 MKLDFSGVWESWPSLVHGTLVTVEITAASLVVGCVLGLLVGLGRLSPQRRVIYGLCTIYL 60 Query: 60 LVFRGSPLLIQMFLVYYGMGQFGVIRESFLWPVLREPYMCAVLSLALCTAGYTAEIIRGG 119 + RG+PLL+Q+FL ++G+ GVI + Y+C +L L + + Y +EI+RG Sbjct: 61 TLVRGTPLLVQLFLWFFGLPHVGVILPA---------YVCGILGLGIYSGAYVSEIVRGA 111 Query: 120 LMAVPVGQIEAGYSIGLSGFALLRRVIGPIALRQCLPAYSTEAVLLVKSTALASLVTVWE 179 + ++ GQ+EA S+GL +RRVI P A + +P E + L+K++AL SL+T+ + Sbjct: 112 IQSIERGQMEAARSLGLPYRMAMRRVILPQAFVRMIPPLGNEFIALIKNSALVSLLTIAD 171 Query: 180 VTGVAQQIIQQTYRTTEVFICAALIYLFLNFVIVRLLGMLE 220 + ++II TYR+ E ++ ALIYL L V +L +E Sbjct: 172 LMHEGEKIISVTYRSLETYLAIALIYLLLTSVTTLILRRVE 212 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 139 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 221 Length adjustment: 23 Effective length of query: 227 Effective length of database: 198 Effective search space: 44946 Effective search space used: 44946 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory