Align Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate HSERO_RS04980 HSERO_RS04980 methionine ABC transporter ATP-binding protein
Query= TCDB::Q9HT70 (335 letters) >FitnessBrowser__HerbieS:HSERO_RS04980 Length = 345 Score = 290 bits (741), Expect = 5e-83 Identities = 160/329 (48%), Positives = 218/329 (66%), Gaps = 13/329 (3%) Query: 18 IPALQPTRLNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGGRILVEGEDVTALDAEGL 77 + A++ L+I+ G+IFG+IG SGAGKSTL+R +N L P+ GRI+++G+D+T+L A L Sbjct: 14 VEAVRKVDLSIRKGEIFGIIGRSGAGKSTLVRTLNLLNRPTSGRIVLDGQDLTSLSAAQL 73 Query: 78 RRFRQRVGMIFQHFNLLSSKTVADNIAMPLRLAGGFSRAEVDARVSELLARVGLSDHARK 137 R R+ +GMIFQHFNLLSS++V DNIA+PL LAG S+AE+ A+V LL VGL+ + Sbjct: 74 REARRGIGMIFQHFNLLSSRSVYDNIALPLELAGK-SKAEIAAKVEPLLELVGLTALRDR 132 Query: 138 YPAQLSGGQKQRVGIARALACRPSILLCDEATSALDPQTTASVLQLLAEINRELKLTIVL 197 YPAQ+SGGQKQRVGIARALA P +LL DEATSALDP+TT S+L+LL +IN+EL LTIVL Sbjct: 133 YPAQISGGQKQRVGIARALANDPKVLLSDEATSALDPETTRSILELLRKINKELGLTIVL 192 Query: 198 ITHEMDVIRRVCDQVAVMDGGAIVEQGDVADVFLHPQHPTTRRFVFEA----------ER 247 ITH+M+VI+++CD+VAVM+ G ++EQG+V DVF P+H TR + + R Sbjct: 193 ITHQMEVIKQICDRVAVMEAGQVIEQGEVLDVFRQPRHEVTRALIGDVIAHELPKGVLAR 252 Query: 248 VDEDERHDDFAHVPGLILRLTFRGEATYAPLLGTVARQTGVDYSILSGRIDRIKDTPYGQ 307 + E D + R F G P L R+ +D++IL G+ID I+ +G Sbjct: 253 LRERLARADAGQGTDHLFRFAFTGNDVDQPHLSEAVRRFNLDFNILHGQIDEIQGQAFGS 312 Query: 308 LTLALVG--GDLEAAMSQLNAADVHVEVL 334 L + G ++ AM L V VE L Sbjct: 313 LAILANGTQDNINQAMQYLREQGVVVEEL 341 Lambda K H 0.322 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 345 Length adjustment: 28 Effective length of query: 307 Effective length of database: 317 Effective search space: 97319 Effective search space used: 97319 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory