Align Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate HSERO_RS11630 HSERO_RS11630 methionine ABC transporter ATP-binding protein
Query= TCDB::Q9HT70 (335 letters) >FitnessBrowser__HerbieS:HSERO_RS11630 Length = 363 Score = 280 bits (715), Expect = 5e-80 Identities = 161/316 (50%), Positives = 200/316 (63%), Gaps = 6/316 (1%) Query: 2 IEFHDVHKTYRVAGREIPALQPTRLNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGGR 61 + V KTY A + ALQ L I G IFG+IG SGAGKS+LLR INRLE P+ GR Sbjct: 13 VALRGVGKTYVSAAGPVQALQDIDLEIAPGSIFGIIGRSGAGKSSLLRTINRLERPTSGR 72 Query: 62 ILVEGEDVTALDAEGLRRFRQRVGMIFQHFNLLSSKTVADNIAMPLRLAGGFSRAEVDAR 121 + V+ D+ LD L R+R+GMIFQHFNLL++KTV DNIA+PLR+AG RA++ R Sbjct: 73 VEVDDVDLATLDETQLVALRRRIGMIFQHFNLLAAKTVFDNIALPLRVAG-VPRAQITQR 131 Query: 122 VSELLARVGLSDHARKYPAQLSGGQKQRVGIARALACRPSILLCDEATSALDPQTTASVL 181 V ELLA VGL D A YP +LSGGQKQRVGIARALA P ILLCDEATSALDP+TT S+L Sbjct: 132 VHELLALVGLQDKADSYPRRLSGGQKQRVGIARALASGPEILLCDEATSALDPETTQSIL 191 Query: 182 QLLAEINRELKLTIVLITHEMDVIRRVCDQVAVMDGGAIVEQGDVADVFLHPQHPTTRRF 241 QLL +INR+L +TI+LITHEM VIR + D+V V++ G + E G+V VF PQH TR Sbjct: 192 QLLRDINRKLGITIILITHEMSVIREIADRVLVLEQGRVAELGEVWQVFGKPQHAATRAL 251 Query: 242 VFEAERVDEDERHDDF-----AHVPGLILRLTFRGEATYAPLLGTVARQTGVDYSILSGR 296 + + E A +L+L F G P L +A G +L Sbjct: 252 LAPLQHGLPQELQQALQPQAPAGRHERVLQLEFHGGDGLQPDLQRIAAVLGGRVRVLQAG 311 Query: 297 IDRIKDTPYGQLTLAL 312 +D I+ +GQL LA+ Sbjct: 312 VDHIQGHTHGQLVLAV 327 Lambda K H 0.322 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 363 Length adjustment: 29 Effective length of query: 306 Effective length of database: 334 Effective search space: 102204 Effective search space used: 102204 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory