Align Probable TonB-dependent receptor, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate HSERO_RS08955 HSERO_RS08955 methionine ABC transporter substrate-binding protein
Query= TCDB::Q9HT68 (260 letters) >FitnessBrowser__HerbieS:HSERO_RS08955 Length = 274 Score = 201 bits (511), Expect = 1e-56 Identities = 105/259 (40%), Positives = 162/259 (62%), Gaps = 3/259 (1%) Query: 5 LAAFSAVAALGLTAAQAAESLTVAATPVPHAEILNVVKPLLAKEGVDLKIKEFTDYVQPN 64 + A S L AQ + + V + I +VVK + A++G++++ F+DY+QPN Sbjct: 16 IGALSLALVPQLGQAQDKQKIKVGISVGSAEAIFDVVKKVAARDGLEIQTVVFSDYLQPN 75 Query: 65 VQVSEKRLDANFFQHQPYLDEFNKAKGTDLVAVTGVHIEPLGAYSSKYKKLDELPSGATV 124 ++ LDAN FQH+PYL+ A+G +V V PLG YS K++ +++LP GA + Sbjct: 76 AALAAGDLDANAFQHRPYLESQIAARGYRIVPVGLTITAPLGIYSRKFRSVEQLPQGAAI 135 Query: 125 VIPNDATNGGRALLLLDKAGVIKLK---DNKSITATPKDIVDNPKNIKIRELEAATLPRV 181 I ND +NG RALLLL KAG+I+LK + ATP D+++NP+ +K+ EL+AA LPR Sbjct: 136 GIQNDPSNGNRALLLLQKAGLIRLKPGVGENGVNATPLDVIENPRKLKLVELDAAQLPRS 195 Query: 182 LTQVDMALINTNYALEAKLNPTKDALAIEGSDSPYVNILVARPDNKDSDAMQKLAKALHS 241 L + A IN +YA +A L+ KD +A+E Y NI+ R ++KD ++KL +A HS Sbjct: 196 LDDLAAASINNDYAFKAGLSLQKDTIAVEDPRGRYANIIATRAEDKDRPWVRKLVQAYHS 255 Query: 242 AEIKQFIQEKYKGAVVPAF 260 E+++FI+ ++KG++VPAF Sbjct: 256 EEVRKFIETEFKGSLVPAF 274 Lambda K H 0.314 0.131 0.354 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 274 Length adjustment: 25 Effective length of query: 235 Effective length of database: 249 Effective search space: 58515 Effective search space used: 58515 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory