Align Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter periplasmic binding protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate HSERO_RS21615 HSERO_RS21615 ABC transporter substrate-binding protein
Query= TCDB::Q9HU31 (250 letters) >FitnessBrowser__HerbieS:HSERO_RS21615 Length = 271 Score = 125 bits (314), Expect = 9e-34 Identities = 80/237 (33%), Positives = 130/237 (54%), Gaps = 4/237 (1%) Query: 12 AATLAFALDASAADKLRIGTEGAYPPFNGIDASGQAVGFDLDIGKALCAKMKTECEVVTS 71 +AT A A+ A +G E AY PF+ + VGFD+DI KAL K+ E + V + Sbjct: 34 SATAAAPQAAAPARVYVVGVESAYAPFSSENEQKDVVGFDIDIMKALAKKIGIEVKFVPT 93 Query: 72 DWDGIIPALNAKKFDFIVASMSITDERKQAVDFTDPYYTNKLQFVAPKSVDFKTDK-DSL 130 ++G L D ++++++ITDERK++V F++PY+ Q +A + D K K + L Sbjct: 94 PFEGFFNFLAQGDRDLLISAITITDERKKSVAFSEPYFV-ATQTIALPAADTKVSKMEDL 152 Query: 131 KGKVIGAQRATIAGTWLEDNMA-DVVTIKLYDTQENAYLDLSSGRLDGVLADKFVQYDWL 189 K +G Q AT ++ + + IK +D+ A +L SG +D V+AD+ V +++ Sbjct: 153 KPLTVGTQSATSGDELVQQVLGKNSAKIKRFDSTPLALKELESGGVDAVVADEPVVKNYI 212 Query: 190 KSDAGKEFEFKGEPVFDNDKIGIAVRKGDP-LREKLNAALKEIVADGTYKKINDKYF 245 ++ + +P F + GIAVRK DP L K+N L E+ ADG++ I+ +YF Sbjct: 213 ANNPNSKLRTVTDPSFPKEDYGIAVRKDDPELLAKINKGLAEMKADGSFAAISAQYF 269 Lambda K H 0.317 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 271 Length adjustment: 24 Effective length of query: 226 Effective length of database: 247 Effective search space: 55822 Effective search space used: 55822 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory