Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate HSERO_RS04980 HSERO_RS04980 methionine ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >FitnessBrowser__HerbieS:HSERO_RS04980 Length = 345 Score = 174 bits (442), Expect = 2e-48 Identities = 99/221 (44%), Positives = 138/221 (62%), Gaps = 1/221 (0%) Query: 43 GCVVGVNDLSLSIGTGEIFVIMGLSGSGKSTLVRHFNRLIDPTSGAILVDGEDILQLDMD 102 G V V + LSI GEIF I+G SG+GKSTLVR N L PTSG I++DG+D+ L Sbjct: 12 GNVEAVRKVDLSIRKGEIFGIIGRSGAGKSTLVRTLNLLNRPTSGRIVLDGQDLTSLSAA 71 Query: 103 ALREFRRHKISMVFQSFGLLPHKSVLDNVAYGLKVRGESKQVCAERALHWINTVGLKGYE 162 LRE RR I M+FQ F LL +SV DN+A L++ G+SK A + + VGL Sbjct: 72 QLREARRG-IGMIFQHFNLLSSRSVYDNIALPLELAGKSKAEIAAKVEPLLELVGLTALR 130 Query: 163 NKYPHQLSGGMRQRVGLARALAADTDIILMDEAFSALDPLIRAEMQDQLLELQKTLHKTI 222 ++YP Q+SGG +QRVG+ARALA D ++L DEA SALDP + + L ++ K L TI Sbjct: 131 DRYPAQISGGQKQRVGIARALANDPKVLLSDEATSALDPETTRSILELLRKINKELGLTI 190 Query: 223 VFITHDLDEAVRIGNRIAILKDGKLIQVGTPREILHSPADE 263 V ITH ++ +I +R+A+++ G++I+ G ++ P E Sbjct: 191 VLITHQMEVIKQICDRVAVMEAGQVIEQGEVLDVFRQPRHE 231 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 345 Length adjustment: 27 Effective length of query: 249 Effective length of database: 318 Effective search space: 79182 Effective search space used: 79182 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory