Align ABC transporter for L-Histidine, permease component (characterized)
to candidate HSERO_RS07845 HSERO_RS07845 metal ABC transporter permease
Query= reanno::pseudo5_N2C3_1:AO356_09615 (283 letters) >FitnessBrowser__HerbieS:HSERO_RS07845 Length = 229 Score = 90.9 bits (224), Expect = 2e-23 Identities = 69/207 (33%), Positives = 110/207 (53%), Gaps = 21/207 (10%) Query: 84 GAVGLWDKLMQTLALMLVATLISVLIGIPLGILSARSNR--------LRSVLMPLLDIMQ 135 G VG D ++TLA+ + +VL+G+PLGIL +NR L VL ++++++ Sbjct: 19 GEVG--DATLETLAMTGGSLFFTVLLGLPLGILLFLTNRRQLLEQRGLYLVLSLVVNVLR 76 Query: 136 TMPSFVYLIPV----LMLFG--LGKVPAIFATVIYAAPPLIRLTDLGIRQVDGEVMEAIN 189 ++P + LI + L L G LG AI VI AP RLT+ +R++D ++EA Sbjct: 77 SVPFLILLIMLIPFTLWLVGTSLGVTGAIPPLVIGTAPFFARLTESVLREIDRGILEACT 136 Query: 190 AFGANRWQQLFGVQLPLALPSIMAGINQTTMMALSMVVIASMIGARGLGE-DVLVGIQTL 248 A GA R Q +FG LP ALP ++A + T + +S ++ +IG GLG+ + G Q Sbjct: 137 AMGARRRQIIFGALLPEALPGLLAAVTITAITLMSYAAMSGVIGGGGLGDLAIRYGYQRF 196 Query: 249 NVGRGLEAGLAIVILAVVIDRITQAYG 275 E + V + VV+ ++ Q +G Sbjct: 197 QT----EVMVVTVAILVVLVQLLQFFG 219 Lambda K H 0.328 0.142 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 283 Length of database: 229 Length adjustment: 24 Effective length of query: 259 Effective length of database: 205 Effective search space: 53095 Effective search space used: 53095 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory