Align enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate HSERO_RS12745 HSERO_RS12745 enoyl-CoA hydratase
Query= BRENDA::Q9I5I4 (272 letters) >FitnessBrowser__HerbieS:HSERO_RS12745 Length = 260 Score = 369 bits (947), Expect = e-107 Identities = 186/253 (73%), Positives = 207/253 (81%) Query: 19 LTVEKHGHTALITINHPPANTWDRDSLIGLRQLIEHLNRDDDIYALVVTGQGPKFFSAGA 78 L +EK GHTA++T+++PPANTW R +L L +L++ LN D DIY LVVTG+G KFFSAGA Sbjct: 7 LKLEKTGHTAVLTLSNPPANTWTRAALADLTRLVKELNADRDIYTLVVTGEGEKFFSAGA 66 Query: 79 DLNMFADGDKARAREMARRFGEAFEALRDFRGVSIAAINGYAMGGGLECALACDIRIAER 138 DL +FADGDKA AREMARRFGEAFE L FRGVSIAAINGYAMGGGLECALACDIRIAE Sbjct: 67 DLKLFADGDKAMAREMARRFGEAFETLSAFRGVSIAAINGYAMGGGLECALACDIRIAEE 126 Query: 139 QAQMALPEAAVGLLPCAGGTQALPWLVGEGWAKRMILCNERVDAETALRIGLVEQVVDSG 198 QAQMALPEAAVGLLPCAGGTQ LPWLVGEGWAKRMILC ERV+AETALRIGLVE+VV G Sbjct: 127 QAQMALPEAAVGLLPCAGGTQNLPWLVGEGWAKRMILCGERVNAETALRIGLVEEVVPRG 186 Query: 199 EARGAALLLAAKVARQSPVAIRTIKPLIQGARERAPNTWLPEERERFVDLFDAQDTREGV 258 +AR AL LA + +QSP ++ K LIQGAR T L ERE FVDLFD QD REGV Sbjct: 187 QARERALALAQQAEKQSPSSVAASKQLIQGARHNPLGTILQTERELFVDLFDTQDQREGV 246 Query: 259 NAFLEKRDPKWRN 271 AFLEKR P+W+N Sbjct: 247 QAFLEKRSPQWKN 259 Lambda K H 0.321 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 260 Length adjustment: 25 Effective length of query: 247 Effective length of database: 235 Effective search space: 58045 Effective search space used: 58045 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory