Align Probable enoyl-CoA hydratase; EC 4.2.1.17 (uncharacterized)
to candidate HSERO_RS20640 HSERO_RS20640 enoyl-CoA hydratase
Query= curated2:P24162 (257 letters) >FitnessBrowser__HerbieS:HSERO_RS20640 Length = 263 Score = 246 bits (627), Expect = 5e-70 Identities = 131/263 (49%), Positives = 176/263 (66%), Gaps = 6/263 (2%) Query: 1 MSYHTIRYEISEGLAVITLDRPEVMNALNAAMRHELTAALHRARGE--ARAIVLTGSGRA 58 MS +I E +G+AVITL+RP+ +N+ AM EL A+ + + R ++LTG+GR Sbjct: 1 MSSPSILLENRDGIAVITLNRPDKLNSFTVAMHLELRDAIATLQADPSVRVLLLTGAGRG 60 Query: 59 FCSGQDLGDGAA----EGLNLETVLREEYEPLLQAIYSCPLPVLAAVNGAAAGAGANLAL 114 FC+GQDLGD A +G++L + + Y PL++++ + P PV+ AVNG AAGAGANL L Sbjct: 61 FCAGQDLGDRAVKPGDDGVDLGESIDKYYGPLVKSLRALPFPVICAVNGVAAGAGANLPL 120 Query: 115 AADVVIAAQSAAFMQAFTRIGLMPDAGGTWWLPRQVGMARAMGMALFAEKIGAEEAARMG 174 A D+V+AA+SA+F++ F ++GL+PD GGT++LPR VG ARAMGMAL EKI AE+A R G Sbjct: 121 ACDIVLAARSASFVEVFCKLGLIPDTGGTYFLPRLVGTARAMGMALLGEKISAEQAERWG 180 Query: 175 LIWEAVPDVDFEHHWRARAAHLARGPSAAFAAVKKAFHAGLSNPLPAQLALEARLQGELG 234 LIW+ V D A AAH AR P+ AA K +A ++ LP QL LE LG Sbjct: 181 LIWKCVDDDQLMEEAHAMAAHFARAPTKGLAATKATLYASPAHTLPEQLDLERDTMRALG 240 Query: 235 QSADFREGVQAFLEKRPPHFTGR 257 +S D+REGV AFLEKR P FTG+ Sbjct: 241 RSRDYREGVTAFLEKRAPQFTGQ 263 Lambda K H 0.321 0.133 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 263 Length adjustment: 24 Effective length of query: 233 Effective length of database: 239 Effective search space: 55687 Effective search space used: 55687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate HSERO_RS20640 HSERO_RS20640 (enoyl-CoA hydratase)
to HMM TIGR02280 (paaB: phenylacetate degradation probable enoyl-CoA hydratase PaaB (EC 4.2.1.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02280.hmm # target sequence database: /tmp/gapView.4002.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02280 [M=256] Accession: TIGR02280 Description: PaaB1: phenylacetate degradation probable enoyl-CoA hydratase PaaB Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-128 412.0 0.4 5.5e-128 411.8 0.4 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS20640 HSERO_RS20640 enoyl-CoA hydratas Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS20640 HSERO_RS20640 enoyl-CoA hydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 411.8 0.4 5.5e-128 5.5e-128 1 256 [] 6 263 .] 6 263 .] 0.99 Alignments for each domain: == domain 1 score: 411.8 bits; conditional E-value: 5.5e-128 TIGR02280 1 illelekgvlrltlnrpdklnsfteemhaelaealerverdd.vrallltGaGrGfcaGqdlsernvt 67 ille ++g++ +tlnrpdklnsft mh el++a+ ++ d vr+llltGaGrGfcaGqdl++r v+ lcl|FitnessBrowser__HerbieS:HSERO_RS20640 6 ILLENRDGIAVITLNRPDKLNSFTVAMHLELRDAIATLQADPsVRVLLLTGAGRGFCAGQDLGDRAVK 73 799999***********************************99************************* PP TIGR02280 68 kg.aapdlGetvekfynplvrrlaalpkpvvvavnGvaaGaGanlalagdivlaaesakfiqafaklG 134 +g + dlGe+++k+y+plv+ l+alp pv++avnGvaaGaGanl la+divlaa+sa+f+ f+klG lcl|FitnessBrowser__HerbieS:HSERO_RS20640 74 PGdDGVDLGESIDKYYGPLVKSLRALPFPVICAVNGVAAGAGANLPLACDIVLAARSASFVEVFCKLG 141 *98999************************************************************** PP TIGR02280 135 lipdsGGtwllprlvGrarakglallgekldaetaaewGliwqvvddealadevqalaahlakqptrg 202 lipd+GGt++lprlvG+ara+g+allgek++ae+a+ wGliw++vdd++l++e++a+aah+a++pt+g lcl|FitnessBrowser__HerbieS:HSERO_RS20640 142 LIPDTGGTYFLPRLVGTARAMGMALLGEKISAEQAERWGLIWKCVDDDQLMEEAHAMAAHFARAPTKG 209 ******************************************************************** PP TIGR02280 203 lalikralqaaetnsldtqldlerdlqrelGrsadyaeGvaafldkrepefkGk 256 la++k +l a+++++l +qldlerd +r lGrs+dy+eGv+afl+kr p+f+G+ lcl|FitnessBrowser__HerbieS:HSERO_RS20640 210 LAATKATLYASPAHTLPEQLDLERDTMRALGRSRDYREGVTAFLEKRAPQFTGQ 263 ****************************************************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (256 nodes) Target sequences: 1 (263 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 7.06 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory