Align 3-ketoacyl-CoA thiolase; Acetyl-CoA acyltransferase; Beta-ketothiolase; EC 2.3.1.16 (characterized)
to candidate HSERO_RS01265 HSERO_RS01265 acetyl-CoA acetyltransferase
Query= SwissProt::O32177 (391 letters) >FitnessBrowser__HerbieS:HSERO_RS01265 Length = 398 Score = 352 bits (902), Expect = e-101 Identities = 191/393 (48%), Positives = 255/393 (64%), Gaps = 5/393 (1%) Query: 1 MKEAVIVSGARTPVGKAKKGSLATVRPDDLGAICVKETLKRAGGYEGN-IDDLIIGCATP 59 +++A IV+ RTP+GKA +G RPDDL ++ + + G + I+D I+GC+ P Sbjct: 5 LQDAYIVAATRTPIGKAPRGMFKNTRPDDLLVRAIQSAVAQVPGLDPKLIEDAIVGCSFP 64 Query: 60 EAEQGLNMARNIGALAGLPYTVPAITVNRYCSSGLQSIAYAAEKIMLGAYDTAIAGGAES 119 E QGLNMARN LAGLP T+ +T+NRYC+SG+ +IA AA++I +G D IA GAES Sbjct: 65 EGAQGLNMARNAVLLAGLPNTIGGVTINRYCASGITAIAMAADRIRVGEADVMIAAGAES 124 Query: 120 MSQVPMMGHVTRPNL-ALAEKAPEYYMSMGHTAEQVAKKYGVSREDQDAFAVRSHQNAAK 178 MS VPMMG N+ A ++ MG TAE+VA+++ VSRE QD F++ SHQ A Sbjct: 125 MSMVPMMGFHPSININAFKDENVGMAYGMGLTAEKVAQQWKVSREAQDEFSLASHQKAIA 184 Query: 179 ALAEGKFKDEIVPVEVT--VTEIGEDHKPMEKQFVFSQDEGVRPQTTADILSTLRPAFSV 236 A G+F DE+ E+ + ++ + V S DEG R + L+ L+P F+ Sbjct: 185 AQEAGEFADEMTSFEIVERFPNLATGEIDVKTRTV-SLDEGPRADSNLAALAKLKPVFAA 243 Query: 237 DGTVTAGNSSQTSDGAAAVMLMDREKADALGLAPLVKFRSFAVGGVPPEVMGIGPVEAIP 296 G+VTAGNSSQTSDGA A++++ + L PL +F SFAV GVPPE+MGIGP EAIP Sbjct: 244 KGSVTAGNSSQTSDGAGALIIVSEKILKQFNLTPLARFVSFAVRGVPPEIMGIGPKEAIP 303 Query: 297 RALKLAGLQLQDIGLFELNEAFASQAIQVIRELGIDEEKVNVNGGAIALGHPLGCTGTKL 356 ALK GL I ELNEAFA+QA+ VI +LG+D KVN GGAIALGHPLG TG Sbjct: 304 AALKAGGLTQDQIDWIELNEAFAAQALAVIGDLGLDPSKVNPMGGAIALGHPLGATGAIR 363 Query: 357 TLSLIHEMKRRNEQFGVVTMCIGGGMGAAGVFE 389 + IH ++R+N ++G+VTMC+G GMGAAG+FE Sbjct: 364 AATTIHALRRKNLKYGMVTMCVGTGMGAAGIFE 396 Lambda K H 0.316 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 412 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 398 Length adjustment: 31 Effective length of query: 360 Effective length of database: 367 Effective search space: 132120 Effective search space used: 132120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate HSERO_RS01265 HSERO_RS01265 (acetyl-CoA acetyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.19201.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-141 456.2 5.4 5.1e-141 456.0 5.4 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS01265 HSERO_RS01265 acetyl-CoA acetylt Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS01265 HSERO_RS01265 acetyl-CoA acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 456.0 5.4 5.1e-141 5.1e-141 1 385 [] 10 396 .. 10 396 .. 0.98 Alignments for each domain: == domain 1 score: 456.0 bits; conditional E-value: 5.1e-141 TIGR01930 1 ivdavRtpig.klggslkelsaedLlaavikellera.gldpekidevilGnvlqageq.aniaReaa 65 iv+a+Rtpig + +g +k+++++dLl+ +i+++++++ gldp+ i+++i+G+++++g+q n+aR+a+ lcl|FitnessBrowser__HerbieS:HSERO_RS01265 10 IVAATRTPIGkAPRGMFKNTRPDDLLVRAIQSAVAQVpGLDPKLIEDAIVGCSFPEGAQgLNMARNAV 77 8*********988******************************************************* PP TIGR01930 66 laaglpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgk 133 l aglp+++ ++t+nr+CaSg++A+a+aa++i++Geadv++a+G+EsmS vp++ + s+++++ lcl|FitnessBrowser__HerbieS:HSERO_RS01265 78 LLAGLPNTIGGVTINRYCASGITAIAMAADRIRVGEADVMIAAGAESMSMVPMMGFH----PSININA 141 ****************************************************96665....5899999 PP TIGR01930 134 akledqllkdlvktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk 201 +k+e+ v ++ mg tAe++a+++++sRe qDe++l+Shqka +A+e+g+f+de + +e+ ++ lcl|FitnessBrowser__HerbieS:HSERO_RS01265 142 FKDEN------VGMAYGMGLTAEKVAQQWKVSREAQDEFSLASHQKAIAAQEAGEFADEMTSFEIVER 203 99999......6779***************************************************99 PP TIGR01930 202 ............kkvvskDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseev 257 +++vs Deg+r++++l++LakLkp+f+ kgs vtAgNssq++DGA+al+++se++ lcl|FitnessBrowser__HerbieS:HSERO_RS01265 204 fpnlatgeidvkTRTVSLDEGPRADSNLAALAKLKPVFAA-KGS-VTAGNSSQTSDGAGALIIVSEKI 269 ***********999************************96.8*7.*********************** PP TIGR01930 258 akelgltplarivsaavagvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelg 325 +k+++ltplar+vs+av gv+pe+mg+gp +Ai++aLk gl+ ++id++E+nEAFAaq+lav+ +lg lcl|FitnessBrowser__HerbieS:HSERO_RS01265 270 LKQFNLTPLARFVSFAVRGVPPEIMGIGPKEAIPAALKAGGLTQDQIDWIELNEAFAAQALAVIGDLG 337 ******************************************************************** PP TIGR01930 326 sldlekvNvnGGAiAlGHPlGasGarivltllkeLkergkkyGlatlCvggGqGaAvile 385 ld++kvN GGAiAlGHPlGa+Ga+ +t++++L++++ kyG++t+Cvg+G+GaA i+e lcl|FitnessBrowser__HerbieS:HSERO_RS01265 338 -LDPSKVNPMGGAIALGHPLGATGAIRAATTIHALRRKNLKYGMVTMCVGTGMGAAGIFE 396 .99******************************************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (398 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.15 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory