Align 3-ketoacyl-CoA thiolase; Acetyl-CoA acyltransferase; Beta-ketothiolase; EC 2.3.1.16 (characterized)
to candidate HSERO_RS01265 HSERO_RS01265 acetyl-CoA acetyltransferase
Query= SwissProt::O32177 (391 letters) >FitnessBrowser__HerbieS:HSERO_RS01265 Length = 398 Score = 352 bits (902), Expect = e-101 Identities = 191/393 (48%), Positives = 255/393 (64%), Gaps = 5/393 (1%) Query: 1 MKEAVIVSGARTPVGKAKKGSLATVRPDDLGAICVKETLKRAGGYEGN-IDDLIIGCATP 59 +++A IV+ RTP+GKA +G RPDDL ++ + + G + I+D I+GC+ P Sbjct: 5 LQDAYIVAATRTPIGKAPRGMFKNTRPDDLLVRAIQSAVAQVPGLDPKLIEDAIVGCSFP 64 Query: 60 EAEQGLNMARNIGALAGLPYTVPAITVNRYCSSGLQSIAYAAEKIMLGAYDTAIAGGAES 119 E QGLNMARN LAGLP T+ +T+NRYC+SG+ +IA AA++I +G D IA GAES Sbjct: 65 EGAQGLNMARNAVLLAGLPNTIGGVTINRYCASGITAIAMAADRIRVGEADVMIAAGAES 124 Query: 120 MSQVPMMGHVTRPNL-ALAEKAPEYYMSMGHTAEQVAKKYGVSREDQDAFAVRSHQNAAK 178 MS VPMMG N+ A ++ MG TAE+VA+++ VSRE QD F++ SHQ A Sbjct: 125 MSMVPMMGFHPSININAFKDENVGMAYGMGLTAEKVAQQWKVSREAQDEFSLASHQKAIA 184 Query: 179 ALAEGKFKDEIVPVEVT--VTEIGEDHKPMEKQFVFSQDEGVRPQTTADILSTLRPAFSV 236 A G+F DE+ E+ + ++ + V S DEG R + L+ L+P F+ Sbjct: 185 AQEAGEFADEMTSFEIVERFPNLATGEIDVKTRTV-SLDEGPRADSNLAALAKLKPVFAA 243 Query: 237 DGTVTAGNSSQTSDGAAAVMLMDREKADALGLAPLVKFRSFAVGGVPPEVMGIGPVEAIP 296 G+VTAGNSSQTSDGA A++++ + L PL +F SFAV GVPPE+MGIGP EAIP Sbjct: 244 KGSVTAGNSSQTSDGAGALIIVSEKILKQFNLTPLARFVSFAVRGVPPEIMGIGPKEAIP 303 Query: 297 RALKLAGLQLQDIGLFELNEAFASQAIQVIRELGIDEEKVNVNGGAIALGHPLGCTGTKL 356 ALK GL I ELNEAFA+QA+ VI +LG+D KVN GGAIALGHPLG TG Sbjct: 304 AALKAGGLTQDQIDWIELNEAFAAQALAVIGDLGLDPSKVNPMGGAIALGHPLGATGAIR 363 Query: 357 TLSLIHEMKRRNEQFGVVTMCIGGGMGAAGVFE 389 + IH ++R+N ++G+VTMC+G GMGAAG+FE Sbjct: 364 AATTIHALRRKNLKYGMVTMCVGTGMGAAGIFE 396 Lambda K H 0.316 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 412 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 398 Length adjustment: 31 Effective length of query: 360 Effective length of database: 367 Effective search space: 132120 Effective search space used: 132120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate HSERO_RS01265 HSERO_RS01265 (acetyl-CoA acetyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.16042.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-141 456.2 5.4 5.1e-141 456.0 5.4 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS01265 HSERO_RS01265 acetyl-CoA acetylt Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS01265 HSERO_RS01265 acetyl-CoA acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 456.0 5.4 5.1e-141 5.1e-141 1 385 [] 10 396 .. 10 396 .. 0.98 Alignments for each domain: == domain 1 score: 456.0 bits; conditional E-value: 5.1e-141 TIGR01930 1 ivdavRtpig.klggslkelsaedLlaavikellera.gldpekidevilGnvlqageq.aniaReaa 65 iv+a+Rtpig + +g +k+++++dLl+ +i+++++++ gldp+ i+++i+G+++++g+q n+aR+a+ lcl|FitnessBrowser__HerbieS:HSERO_RS01265 10 IVAATRTPIGkAPRGMFKNTRPDDLLVRAIQSAVAQVpGLDPKLIEDAIVGCSFPEGAQgLNMARNAV 77 8*********988******************************************************* PP TIGR01930 66 laaglpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgk 133 l aglp+++ ++t+nr+CaSg++A+a+aa++i++Geadv++a+G+EsmS vp++ + s+++++ lcl|FitnessBrowser__HerbieS:HSERO_RS01265 78 LLAGLPNTIGGVTINRYCASGITAIAMAADRIRVGEADVMIAAGAESMSMVPMMGFH----PSININA 141 ****************************************************96665....5899999 PP TIGR01930 134 akledqllkdlvktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk 201 +k+e+ v ++ mg tAe++a+++++sRe qDe++l+Shqka +A+e+g+f+de + +e+ ++ lcl|FitnessBrowser__HerbieS:HSERO_RS01265 142 FKDEN------VGMAYGMGLTAEKVAQQWKVSREAQDEFSLASHQKAIAAQEAGEFADEMTSFEIVER 203 99999......6779***************************************************99 PP TIGR01930 202 ............kkvvskDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseev 257 +++vs Deg+r++++l++LakLkp+f+ kgs vtAgNssq++DGA+al+++se++ lcl|FitnessBrowser__HerbieS:HSERO_RS01265 204 fpnlatgeidvkTRTVSLDEGPRADSNLAALAKLKPVFAA-KGS-VTAGNSSQTSDGAGALIIVSEKI 269 ***********999************************96.8*7.*********************** PP TIGR01930 258 akelgltplarivsaavagvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelg 325 +k+++ltplar+vs+av gv+pe+mg+gp +Ai++aLk gl+ ++id++E+nEAFAaq+lav+ +lg lcl|FitnessBrowser__HerbieS:HSERO_RS01265 270 LKQFNLTPLARFVSFAVRGVPPEIMGIGPKEAIPAALKAGGLTQDQIDWIELNEAFAAQALAVIGDLG 337 ******************************************************************** PP TIGR01930 326 sldlekvNvnGGAiAlGHPlGasGarivltllkeLkergkkyGlatlCvggGqGaAvile 385 ld++kvN GGAiAlGHPlGa+Ga+ +t++++L++++ kyG++t+Cvg+G+GaA i+e lcl|FitnessBrowser__HerbieS:HSERO_RS01265 338 -LDPSKVNPMGGAIALGHPLGATGAIRAATTIHALRRKNLKYGMVTMCVGTGMGAAGIFE 396 .99******************************************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (398 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 6.96 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory