Align high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized)
to candidate HSERO_RS08290 HSERO_RS08290 leucine/isoleucine/valine transporter ATP-binding subunit
Query= CharProtDB::CH_003736 (237 letters) >FitnessBrowser__HerbieS:HSERO_RS08290 Length = 234 Score = 325 bits (832), Expect = 6e-94 Identities = 164/232 (70%), Positives = 191/232 (82%) Query: 5 MLSFDKVSAHYGKIQALHEVSLHINQGEIVTLIGANGAGKTTLLGTLCGDPRATSGRIVF 64 ML FDKV HYG I+ALH VSL++ +GEIVTLIGANGAGKTTLL TLCG PRA+SGR++F Sbjct: 1 MLQFDKVHTHYGAIEALHGVSLNVEKGEIVTLIGANGAGKTTLLMTLCGRPRASSGRVIF 60 Query: 65 DDKDITDWQTAKIMREAVAIVPEGRRVFSRMTVEENLAMGGFFAERDQFQERIKWVYELF 124 + +DIT QT +IMR +AI PEGRRVF +TV ENL MG FFA + ++ I++V+ LF Sbjct: 61 EGQDITQLQTHEIMRRGLAISPEGRRVFPSLTVLENLKMGAFFASNEAIEQGIEYVFGLF 120 Query: 125 PRLHERRIQRAGTMSGGEQQMLAIGRALMSNPRLLLLDEPSLGLAPIIIQQIFDTIEQLR 184 PRL ER QRAGTMSGGEQQMLAIGRALMS PRLLLLDEP+LGLAP++I QIFD I +R Sbjct: 121 PRLKERAAQRAGTMSGGEQQMLAIGRALMSKPRLLLLDEPTLGLAPLVIAQIFDIIRTIR 180 Query: 185 EQGMTIFLVEQNANQALKLADRGYVLENGHVVLSDTGDALLANEAVRSAYLG 236 E G+T+FLVEQNAN+AL +ADRGYVLENGHVV+SDTG LLAN VR AYLG Sbjct: 181 ESGVTVFLVEQNANKALGVADRGYVLENGHVVMSDTGANLLANSDVRKAYLG 232 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 234 Length adjustment: 23 Effective length of query: 214 Effective length of database: 211 Effective search space: 45154 Effective search space used: 45154 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory