GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lpd in Herbaspirillum seropedicae SmR1

Align Dihydrolipoyl dehydrogenase; Dihydrolipoamide dehydrogenase; E3 component of 2-oxoglutarate dehydrogenase complex; EC 1.8.1.4 (characterized)
to candidate HSERO_RS14875 HSERO_RS14875 dihydrolipoamide dehydrogenase

Query= SwissProt::P14218
         (478 letters)



>lcl|FitnessBrowser__HerbieS:HSERO_RS14875 HSERO_RS14875
           dihydrolipoamide dehydrogenase
          Length = 475

 Score =  514 bits (1325), Expect = e-150
 Identities = 270/476 (56%), Positives = 338/476 (71%), Gaps = 7/476 (1%)

Query: 1   MSQKFDVVVIGAGPGGYVAAIRAAQLGLKTACIEKYIGKEGKVALGGTCLNVGCIPSKAL 60
           MS+ FDVVVIG GPGGY+AAIRAAQLG  TACI+++  ++G  A GGTC NVGCIPSKAL
Sbjct: 1   MSKNFDVVVIGGGPGGYIAAIRAAQLGFNTACIDEWKNEKGGPAPGGTCTNVGCIPSKAL 60

Query: 61  LDSSYKYHEAKEAFKVHGIEAKGVTIDVPAMVARKANIVKNLTGGIATLFKANGVTSFEG 120
           L SS  Y  A   F  HGIE KG+ +++  M+ RK  +VK    GI  LFK N V+ F G
Sbjct: 61  LQSSEHYEHASHGFAEHGIEVKGLGLNLEKMLGRKNTVVKQNNDGILYLFKKNKVSFFHG 120

Query: 121 HGKLLANK----QVEVTGLDGKTQVLEAENVIIASGSRPVEIPPAPLSDDIIVDSTGALE 176
            G  +       +++V G   +T  + A++VI+A+GS    +P A   + +I+ +TGAL 
Sbjct: 121 RGSFVKGDANGYEIKVAGAAEET--ITAKHVIVATGSNARALPGAEFDEKLILSNTGALS 178

Query: 177 FQAVPKKLGVIGAGVIGLELGSVWARLGAEVTVLEALDKFLPAADEQIAKEALKVLTKQG 236
              VPKKLGVIGAGVIGLE+GSVW RLGAEVTVLEAL  FL A DEQIAKEA K+LTKQG
Sbjct: 179 ITEVPKKLGVIGAGVIGLEMGSVWRRLGAEVTVLEALPTFLGAVDEQIAKEAQKLLTKQG 238

Query: 237 LNIRLGARVTASEVKKKQVTVTFTDANGEQKE-TFDKLIVAVGRRPVTTDLLAADSGVTL 295
           L + LG ++ A +  K  V+V +TDA G+     FDKLIV++GR P T  L A   G+ L
Sbjct: 239 LAVNLGVKIGAIKAGKNSVSVEYTDAKGDAHTGEFDKLIVSIGRTPNTIGLNAEGVGLKL 298

Query: 296 DERGFIYVDDHCKTSVPGVFAIGDVVRGAMLAHKASEEGVMVAERIAGHKAQMNYDLIPS 355
           DERGFI VD  CKT++P V+A+GDVVRG MLAHKA EEGV VAERIAG    +N++ IP 
Sbjct: 299 DERGFIAVDGDCKTNLPNVWAVGDVVRGPMLAHKAEEEGVAVAERIAGQHGHVNFNTIPW 358

Query: 356 VIYTHPEIAWVGKTEQTLKAEGVEVNVGTFPFAASGRAMAANDTTGLVKVIADAKTDRVL 415
           VIYT PEIAWVGKTEQ LKAEGV+   GTFPF A+GRA A  DT+G+VK +ADAKTD +L
Sbjct: 359 VIYTSPEIAWVGKTEQQLKAEGVQYKAGTFPFLANGRARALGDTSGMVKFLADAKTDEIL 418

Query: 416 GVHVIGPSAAELVQQGAIGMEFGTSAEDLGMMVFSHPTLSEALHEAALAVNGHAIH 471
           GVH++GP A+EL+ +  + MEF  S+ED+  +  +HP+LSEA  EAALAV+  A++
Sbjct: 419 GVHIVGPMASELISEAVVAMEFRASSEDIARICHAHPSLSEATKEAALAVDKRALN 474


Lambda     K      H
   0.316    0.134    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 682
Number of extensions: 33
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 478
Length of database: 475
Length adjustment: 33
Effective length of query: 445
Effective length of database: 442
Effective search space:   196690
Effective search space used:   196690
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (24.3 bits)

Align candidate HSERO_RS14875 HSERO_RS14875 (dihydrolipoamide dehydrogenase)
to HMM TIGR01350 (lpdA: dihydrolipoyl dehydrogenase (EC 1.8.1.4))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01350.hmm
# target sequence database:        /tmp/gapView.18362.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01350  [M=461]
Accession:   TIGR01350
Description: lipoamide_DH: dihydrolipoyl dehydrogenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                  -----------
   1.2e-166  540.9   4.1   1.4e-166  540.7   4.1    1.0  1  lcl|FitnessBrowser__HerbieS:HSERO_RS14875  HSERO_RS14875 dihydrolipoamide d


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__HerbieS:HSERO_RS14875  HSERO_RS14875 dihydrolipoamide dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  540.7   4.1  1.4e-166  1.4e-166       1     460 [.       4     474 ..       4     475 .] 0.95

  Alignments for each domain:
  == domain 1  score: 540.7 bits;  conditional E-value: 1.4e-166
                                  TIGR01350   1 eydvvviGgGpgGYvaAiraaqlglkvalvek..ek.....lGGtClnvGCiPtKalLksaevveelk 61 
                                                ++dvvviGgGpgGY+aAiraaqlg+++a++++  ++      GGtC+nvGCiP+KalL+s+e +e+++
  lcl|FitnessBrowser__HerbieS:HSERO_RS14875   4 NFDVVVIGGGPGGYIAAIRAAQLGFNTACIDEwkNEkggpaPGGTCTNVGCIPSKALLQSSEHYEHAS 71 
                                                69****************************86532223333799************************ PP

                                  TIGR01350  62 e.akelgievenvkldlekllerkekvvkklvgGvkaLlkknkvevikGeaklld....kkevevkke 124
                                                + ++e+giev+++ l+lek+l rk++vvk+ ++G+ +L+kknkv+ ++G++++++      e++v++ 
  lcl|FitnessBrowser__HerbieS:HSERO_RS14875  72 HgFAEHGIEVKGLGLNLEKMLGRKNTVVKQNNDGILYLFKKNKVSFFHGRGSFVKgdanGYEIKVAGA 139
                                                *****************************************************986655568999999 PP

                                  TIGR01350 125 kkekkleakniiiAtGseprelplkleedekvvitseealelkevpeslvivGgGviGvEfasifakl 192
                                                + e++++ak++i+AtGs+ r+lp+  e+dek+++++++al+++evp++l ++G+GviG+E++s++++l
  lcl|FitnessBrowser__HerbieS:HSERO_RS14875 140 A-EETITAKHVIVATGSNARALPG-AEFDEKLILSNTGALSITEVPKKLGVIGAGVIGLEMGSVWRRL 205
                                                8.57********************.9****************************************** PP

                                  TIGR01350 193 Gvkvtvielldrilpaldaevskvlkkklkkkgvkiltnakvtevekeedevv..veakkkevetlea 258
                                                G++vtv+e+l++ l a+d++++k+++k l+k+g+ +  + k+ ++++ +++v+  ++  k++++t e 
  lcl|FitnessBrowser__HerbieS:HSERO_RS14875 206 GAEVTVLEALPTFLGAVDEQIAKEAQKLLTKQGLAVNLGVKIGAIKAGKNSVSveYTDAKGDAHTGEF 273
                                                *******************************************999999999943444555899999* PP

                                  TIGR01350 259 ekvLvavGrkpnleelgleklgveldergaikvdeelrtnvpgiyaiGDvigklmLAhvAskegvvaa 326
                                                +k++v++Gr+pn+ +l+ e +g++lderg+i vd +++tn+p+++a+GDv++++mLAh+A++egv +a
  lcl|FitnessBrowser__HerbieS:HSERO_RS14875 274 DKLIVSIGRTPNTIGLNAEGVGLKLDERGFIAVDGDCKTNLPNVWAVGDVVRGPMLAHKAEEEGVAVA 341
                                                ******************************************************************** PP

                                  TIGR01350 327 ekiagkekseidykavPsviytePevasvGlteeqakeegievkvgkfpfaangkalaleetdGfvkv 394
                                                e+iag++  +++ +++P viyt+Pe+a vG+te+q+k+eg+++k+g fpf ang+a+al++t+G+vk 
  lcl|FitnessBrowser__HerbieS:HSERO_RS14875 342 ERIAGQHG-HVNFNTIPWVIYTSPEIAWVGKTEQQLKAEGVQYKAGTFPFLANGRARALGDTSGMVKF 408
                                                *****998.9********************************************************** PP

                                  TIGR01350 395 ivdkktgeilGahivgaeaseliselalaveleltveelaktihpHPtlsEaikeaalaalgkaih 460
                                                ++d kt+eilG+hivg+ aselise+++a+e+++++e++a+++h+HP+lsEa+keaala+ ++a++
  lcl|FitnessBrowser__HerbieS:HSERO_RS14875 409 LADAKTDEILGVHIVGPMASELISEAVVAMEFRASSEDIARICHAHPSLSEATKEAALAVDKRALN 474
                                                ***********************************************************9998876 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (461 nodes)
Target sequences:                          1  (475 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02
# Mc/sec: 10.07
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory