Align 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 (characterized)
to candidate HSERO_RS14890 HSERO_RS14890 type II citrate synthase
Query= SwissProt::O34002 (379 letters) >FitnessBrowser__HerbieS:HSERO_RS14890 Length = 433 Score = 189 bits (480), Expect = 1e-52 Identities = 127/390 (32%), Positives = 193/390 (49%), Gaps = 22/390 (5%) Query: 5 TIHKGLAGVTADVTAISKVNSDTNSLLYRGYPVQELAAKCSFEQVAYLLWNSELPNDSEL 64 T G + ++I+ ++ D LLYRGYP+++LA C F + YLL + ELPN + Sbjct: 46 TYDPGFMSTASCNSSITYIDGDKGELLYRGYPIEQLAVNCDFLESCYLLLHGELPNAEQK 105 Query: 65 KAFVNFERSHRKLDENVKGAIDLLSTACHPMDVARTAVSVLGANHARAQDSSPEANLE-K 123 K FVN H + E + HPM V +V L A + + D S + E Sbjct: 106 KVFVNTVTQHTMVHEQMNFFFRGFRRDAHPMAVLTGSVGALSAFYHDSLDISNANHREVS 165 Query: 124 AMSLLATFPSVVAYDQRRRRGEELIEPREDLDYSANFLWMTFGE-----EAAPEVVEAFN 178 A+ ++A P++VA + G+ + PR DL Y+ANF+ M F + +V A + Sbjct: 166 AIRMIAKLPTLVAMAYKYSIGQPFVYPRNDLSYTANFMRMMFANPCEEYQVNEVLVRALD 225 Query: 179 VSMILYAEHSFNASTFTARVITSTLADLHSAVTGAIGALKGPLHGGANEAVMHTFEEIGI 238 +IL+A+H NAST T R+ S+ A+ + + I L GP HGGANEA ++ E+IG Sbjct: 226 RILILHADHEQNASTSTVRLAGSSGANPFACIAAGIACLWGPAHGGANEAALNMLEQIG- 284 Query: 239 RKDESLDEAATRSKAWMVDALAQKKKVMGFGHRVYKNGDSRVPTMKSALDAMIKH---YD 295 S+D+ K V K+MGFGHRVYKN D R M+ ++ +D Sbjct: 285 ----SVDKIPEFIK--QVKDKNSGVKLMGFGHRVYKNYDPRAKLMRETCYEVLNELGLHD 338 Query: 296 RPEMLGLYNGLEAAMEE----AKQIKPNLDYPAGPTYNLMGFDTEMFTPLFIAARITGWT 351 P + A+E+ ++++ PN+D+ +G +G T MFT +F AR GW Sbjct: 339 DPLFKLAMELEKIALEDEYFVSRKLYPNVDFYSGIVQRALGIPTSMFTCIFAMARTIGWI 398 Query: 352 AHIMEQVAD--NALIRPLSEYNGPEQRQVP 379 A E ++D + RP + G +R VP Sbjct: 399 AQWNEMISDPEQKIGRPRQLFVGSPRRDVP 428 Lambda K H 0.316 0.130 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 379 Length of database: 433 Length adjustment: 31 Effective length of query: 348 Effective length of database: 402 Effective search space: 139896 Effective search space used: 139896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory