Align 2-dehydro-3-deoxyglucono/galactono-kinase (EC 2.7.1.178) (characterized)
to candidate HSERO_RS07545 HSERO_RS07545 2-dehydro-3-deoxygluconokinase
Query= BRENDA::Q97U29 (313 letters) >FitnessBrowser__HerbieS:HSERO_RS07545 Length = 313 Score = 129 bits (324), Expect = 9e-35 Identities = 99/311 (31%), Positives = 146/311 (46%), Gaps = 12/311 (3%) Query: 2 VDVIALGEPLIQFNSFNPGPLRFVNYFEKHVAGSELNFCIAVVRNHLSCSLIARVGNDEF 61 +DV+ GE L + GP V + + +AG+E N I + R L +RVGND F Sbjct: 5 LDVVTWGEALALLVADEVGPFEEVEKYTRRLAGAETNVAIGLARLGLKVGWASRVGNDAF 64 Query: 62 GKNIIEYSRAQGIDTSHIKVDNESFTGIYFIQRGYPIPMKSELVYYRKGSAGSRLSPEDI 121 G+ I + +G++ S + D E T I + + YYRKGSA S LS +D Sbjct: 65 GRFIRQRVAQEGVEVSRVITDMEFRTAIQLKAKAVG-GADPAIEYYRKGSAASHLSVDDF 123 Query: 122 NENYVRNSRLVHSTGITLAISDNAKEAVIKAFEL----AKSRSLDTNIRPKLWSSLEKAK 177 + Y +R +H+TGI A+S +A + K+ S D N+RP LW S E Sbjct: 124 DAGYFGAARHLHATGIAPALSATTMAFAHQAMDFMRGQGKTISFDPNLRPMLWPSQEVMA 183 Query: 178 ETILSILKKYDIEVLITDPDDTKILLDVTDPDEAYRKYKELGVKVLLYKLGSKGAIAYKD 237 + + ++ K D ++ + KIL D E Y E GVK+++ KLG++G AY Sbjct: 184 QQLNALAFKAD--WVLPGLSEGKILTGHDDAREIAGFYLERGVKLVVIKLGAEG--AYWR 239 Query: 238 NVKAFKDAYKVPVE---DPTGAGDAMAGTFVSLYLQGKDIEYSLAHGIAASTLVITVRGD 294 N + VPV+ D GAGD A +S L+G + ++ G I V GD Sbjct: 240 NGQGEGRVAGVPVKEVVDTVGAGDGFAVGVISGMLEGLPVPQAVMRGNRIGAFAIQVVGD 299 Query: 295 NELTPTLEDAE 305 E PT + E Sbjct: 300 MEGLPTRAELE 310 Lambda K H 0.317 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 313 Length adjustment: 27 Effective length of query: 286 Effective length of database: 286 Effective search space: 81796 Effective search space used: 81796 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory