Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate HSERO_RS10045 HSERO_RS10045 UDP-glucose 4-epimerase
Query= curated2:P55180 (339 letters) >FitnessBrowser__HerbieS:HSERO_RS10045 Length = 343 Score = 447 bits (1150), Expect = e-130 Identities = 213/327 (65%), Positives = 260/327 (79%) Query: 3 ILVTGGAGYIGSHTCVELLNSGYEIVVLDNLSNSSAEALNRVKEITGKDLTFYEADLLDR 62 ILVTGGAGYIGSHTCVEL+++GY +VVLDNL NS A ++R+ +I+G+ F + D+ DR Sbjct: 6 ILVTGGAGYIGSHTCVELIHAGYAVVVLDNLCNSRASVIDRIAQISGQRPHFVQGDIRDR 65 Query: 63 EAVDSVFAENEIEAVIHFAGLKAVGESVAIPLKYYHNNLTGTFILCEAMEKYGVKKIVFS 122 +D +F + IEAVIHFAGLKAVGESVA PL+YY NN+ G+ +L EAM +GVK IVFS Sbjct: 66 AVLDGIFKSHRIEAVIHFAGLKAVGESVAQPLRYYDNNVHGSNVLFEAMAAHGVKNIVFS 125 Query: 123 SSATVYGVPETSPITEDFPLGATNPYGQTKLMLEQILRDLHTADNEWSVALLRYFNPFGA 182 SSATVYG P + PITE+FPL ATNPYG++KLM+EQIL DLH AD W +ALLRYFNP GA Sbjct: 126 SSATVYGDPASVPITEEFPLSATNPYGRSKLMVEQILGDLHVADPSWRIALLRYFNPVGA 185 Query: 183 HPSGRIGEDPNGIPNNLMPYVAQVAVGKLEQLSVFGNDYPTKDGTGVRDYIHVVDLAEGH 242 H SG IGEDP+GIPNNL+P++AQVA G+ LSV+G+DYPT DGTGVRDYIHVVDLA GH Sbjct: 186 HESGLIGEDPSGIPNNLLPFIAQVADGRRAALSVYGSDYPTPDGTGVRDYIHVVDLALGH 245 Query: 243 VKALEKVLNSTGADAYNLGTGTGYSVLEMVKAFEKVSGKEVPYRFADRRPGDIATCFADP 302 +K L K+ G YNLGTG G SVLEM+ AFE+ G ++PY+ DRRPGDIA C+A Sbjct: 246 LKTLRKLEQGPGVYTYNLGTGRGNSVLEMLAAFEQACGNKLPYQLVDRRPGDIACCYAAT 305 Query: 303 AKAKRELGWEAKRGLEEMCADSWRWQS 329 +A+RELGW A+RG+E MCAD+WRWQ+ Sbjct: 306 ERAERELGWRAQRGIEAMCADTWRWQA 332 Lambda K H 0.315 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 450 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 343 Length adjustment: 29 Effective length of query: 310 Effective length of database: 314 Effective search space: 97340 Effective search space used: 97340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate HSERO_RS10045 HSERO_RS10045 (UDP-glucose 4-epimerase)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.2107839.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.2e-142 457.8 0.0 9.6e-142 457.6 0.0 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS10045 HSERO_RS10045 UDP-glucose 4-epim Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS10045 HSERO_RS10045 UDP-glucose 4-epimerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 457.6 0.0 9.6e-142 9.6e-142 2 327 .. 6 333 .. 5 338 .. 0.99 Alignments for each domain: == domain 1 score: 457.6 bits; conditional E-value: 9.6e-142 TIGR01179 2 iLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekit..evklvegdladkekleavle 67 iLvtGgaGyiGsh++++l ++g+ vvvlDnl+++ ++++ ++ +i+ + ++v+gd++d++ l+ +++ lcl|FitnessBrowser__HerbieS:HSERO_RS10045 6 ILVTGGAGYIGSHTCVELIHAGYAVVVLDNLCNSRASVIDRIAQISgqRPHFVQGDIRDRAVLDGIFK 73 9********************************************99999****************** PP TIGR01179 68 eekidaviHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisE 135 +++i+aviHfa+l+avgEsv++Pl+YY+nnv+++ +L eam+++gvk+++Fsssa+vYg++ +vpi+E lcl|FitnessBrowser__HerbieS:HSERO_RS10045 74 SHRIEAVIHFAGLKAVGESVAQPLRYYDNNVHGSNVLFEAMAAHGVKNIVFSSSATVYGDPASVPITE 141 ******************************************************************** PP TIGR01179 136 esplnpinpYGrsklmvErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknat.hliklvaev 202 e+pl+++npYGrsklmvE+il dl+ ad+++++++LRYFn++GA+e+g iGe++++++ +l++ +a+v lcl|FitnessBrowser__HerbieS:HSERO_RS10045 142 EFPLSATNPYGRSKLMVEQILGDLHVADPSWRIALLRYFNPVGAHESGLIGEDPSGIPnNLLPFIAQV 209 **********************************************************9********* PP TIGR01179 203 avgkrekleifGtdyptkDGtcvRDyiHveDlaeaHlaalealeeggesevynlGagqgfsvkeviea 270 a g+r +l+++G dypt+DGt+vRDyiHv Dla +Hl++l++le+g ++ +ynlG+g+g+sv+e++ a lcl|FitnessBrowser__HerbieS:HSERO_RS10045 210 ADGRRAALSVYGSDYPTPDGTGVRDYIHVVDLALGHLKTLRKLEQGPGVYTYNLGTGRGNSVLEMLAA 277 ******************************************************************** PP TIGR01179 271 vkkvsgkdikveladrRaGDpaslvadaskikrelgwkpkyddLeeiiksawdWekk 327 +++++g++++++l drR+GD+a+++a +++++relgw+++++ +e +++++w+W+ lcl|FitnessBrowser__HerbieS:HSERO_RS10045 278 FEQACGNKLPYQLVDRRPGDIACCYAATERAERELGWRAQRG-IEAMCADTWRWQAL 333 ******************************************.***********975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (343 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 25.72 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory