GapMind for catabolism of small carbon sources

 

Aligments for a candidate for galE in Herbaspirillum seropedicae SmR1

Align UDP-glucose 4-epimerase (EC 5.1.3.7; EC 5.1.3.2) (characterized)
to candidate HSERO_RS22045 HSERO_RS22045 UDP-glucose 4-epimerase

Query= metacyc::BSU38860-MONOMER
         (339 letters)



>lcl|FitnessBrowser__HerbieS:HSERO_RS22045 HSERO_RS22045 UDP-glucose
           4-epimerase
          Length = 336

 Score =  445 bits (1145), Expect = e-130
 Identities = 214/337 (63%), Positives = 268/337 (79%), Gaps = 1/337 (0%)

Query: 1   MAILVTGGAGYIGSHTCVELLNSGYEIVVLDNLSNSSAEALNRVKEITGKDLTFYEADLL 60
           M ILVTGGAGYIGSHTCVELL +G+E++V DN  NSS E++ RV++ITGK L+  + D+ 
Sbjct: 1   MNILVTGGAGYIGSHTCVELLKAGHEVIVFDNFCNSSPESVKRVQQITGKTLSLVKGDIR 60

Query: 61  DREAVDSVFAENEIEAVIHFAGLKAVGESVAIPLKYYHNNLTGTFILCEAMEKYGVKKIV 120
           +RE ++SV  E + EAVIHFAGLKAVGESV  PL YY NN+ GT  L EAM+  GVK IV
Sbjct: 61  NREQLESVLREFKCEAVIHFAGLKAVGESVEQPLMYYDNNVVGTVRLLEAMQATGVKTIV 120

Query: 121 FSSSATVYGVPETSPITEDFPLGATNPYGQTKLMLEQILRDLHTADNEWSVALLRYFNPF 180
           FSSSATVYG P+  P+ E  PL A+NPYG++K+++E +LRD + A  +W +ALLRYFNP 
Sbjct: 121 FSSSATVYGDPQYLPLDEAHPLSASNPYGRSKIVIEDMLRDYYRAHPDWKIALLRYFNPV 180

Query: 181 GAHPSGRIGEDPNGIPNNLMPYVAQVAVGKLEQLSVFGNDYPTKDGTGVRDYIHVVDLAE 240
           GAH SG IGEDP GIPNNLMP+VAQVA+G+ E+L+++G DYPT DGTGVRD+IHVVDLA 
Sbjct: 181 GAHESGLIGEDPGGIPNNLMPFVAQVAIGRRERLNIWGGDYPTPDGTGVRDFIHVVDLAR 240

Query: 241 GHVKALEKVLNSTGADAYNLGTGTGYSVLEMVKAFEKVSGKEVPYRFADRRPGDIATCFA 300
           GHV AL+  L++    A NLGTG GYSVL+++KA+EK  GK +PY  A+RRPGDIA+C+A
Sbjct: 241 GHVAALQ-ALDAPQCFAVNLGTGVGYSVLDVLKAYEKACGKTLPYAIAERRPGDIASCYA 299

Query: 301 DPAKAKRELGWEAKRGLEEMCADSWRWQSSNVNGYKS 337
           +PA+AKR+LGWEA  GLE MCADSW+WQ  N NG+K+
Sbjct: 300 NPAEAKRKLGWEATLGLEAMCADSWKWQQMNPNGFKA 336


Lambda     K      H
   0.315    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 446
Number of extensions: 10
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 339
Length of database: 336
Length adjustment: 28
Effective length of query: 311
Effective length of database: 308
Effective search space:    95788
Effective search space used:    95788
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 49 (23.5 bits)

Align candidate HSERO_RS22045 HSERO_RS22045 (UDP-glucose 4-epimerase)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01179.hmm
# target sequence database:        /tmp/gapView.15661.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01179  [M=332]
Accession:   TIGR01179
Description: galE: UDP-glucose 4-epimerase GalE
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                  -----------
   7.9e-141  454.6   0.0     9e-141  454.4   0.0    1.0  1  lcl|FitnessBrowser__HerbieS:HSERO_RS22045  HSERO_RS22045 UDP-glucose 4-epim


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__HerbieS:HSERO_RS22045  HSERO_RS22045 UDP-glucose 4-epimerase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  454.4   0.0    9e-141    9e-141       1     331 [.       2     333 ..       2     334 .. 0.99

  Alignments for each domain:
  == domain 1  score: 454.4 bits;  conditional E-value: 9e-141
                                  TIGR01179   1 kiLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekit..evklvegdladkekleavl 66 
                                                +iLvtGgaGyiGsh++++ll++g+ev+v+Dn +++s e++k++++it  +++lv+gd++++e+le+vl
  lcl|FitnessBrowser__HerbieS:HSERO_RS22045   2 NILVTGGAGYIGSHTCVELLKAGHEVIVFDNFCNSSPESVKRVQQITgkTLSLVKGDIRNREQLESVL 69 
                                                59********************************************99999***************** PP

                                  TIGR01179  67 eeekidaviHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpis 134
                                                +e k +aviHfa+l+avgEsv++Pl YY+nnvv+t++Lleamq++gvk+++Fsssa+vYg+++ +p+ 
  lcl|FitnessBrowser__HerbieS:HSERO_RS22045  70 REFKCEAVIHFAGLKAVGESVEQPLMYYDNNVVGTVRLLEAMQATGVKTIVFSSSATVYGDPQYLPLD 137
                                                ******************************************************************** PP

                                  TIGR01179 135 EesplnpinpYGrsklmvErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknat.hliklvae 201
                                                E++pl++ npYGrsk+++E +l+d+ +a++++k+++LRYFn++GA+e+g iGe++ +++ +l++ va+
  lcl|FitnessBrowser__HerbieS:HSERO_RS22045 138 EAHPLSASNPYGRSKIVIEDMLRDYYRAHPDWKIALLRYFNPVGAHESGLIGEDPGGIPnNLMPFVAQ 205
                                                ***********************************************************9******** PP

                                  TIGR01179 202 vavgkrekleifGtdyptkDGtcvRDyiHveDlaeaHlaalealeeggesevynlGagqgfsvkevie 269
                                                va+g+re+l+i+G+dypt+DGt+vRD+iHv Dla +H+aal+al +  +  + nlG+g g+sv++v++
  lcl|FitnessBrowser__HerbieS:HSERO_RS22045 206 VAIGRRERLNIWGGDYPTPDGTGVRDFIHVVDLARGHVAALQALDA-PQCFAVNLGTGVGYSVLDVLK 272
                                                ********************************************96.888899*************** PP

                                  TIGR01179 270 avkkvsgkdikveladrRaGDpaslvadaskikrelgwkpkyddLeeiiksawdWekklkeg 331
                                                a +k++gk++++ +a+rR+GD+as++a+++++kr+lgw+++++ Le +++++w+W++ +++g
  lcl|FitnessBrowser__HerbieS:HSERO_RS22045 273 AYEKACGKTLPYAIAERRPGDIASCYANPAEAKRKLGWEATLG-LEAMCADSWKWQQMNPNG 333
                                                *******************************************.*************99875 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (332 nodes)
Target sequences:                          1  (336 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 7.50
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory