Align ABC transporter for D-Glucose-6-Phosphate, permease component 2 (characterized)
to candidate HSERO_RS01340 HSERO_RS01340 sugar ABC transporter permease
Query= reanno::WCS417:GFF4323 (302 letters) >FitnessBrowser__HerbieS:HSERO_RS01340 Length = 311 Score = 132 bits (331), Expect = 1e-35 Identities = 85/276 (30%), Positives = 143/276 (51%), Gaps = 6/276 (2%) Query: 25 LAPSMFIVLVGFYGYILWTFVLSFTNSTFLPTYKWAGLAQYARLFDNDRWWVASKNLAVF 84 LAP+ + LV IL+T LSF + + ++ GLA Y LF ++ A KN ++ Sbjct: 42 LAPACVMTLVYVLYPILYTIYLSFFSWDGMTEPRFVGLANYVELFHAPTFYTALKNNVLW 101 Query: 85 GGMFIGITLVIGVTLAIFLDQKIRREGFIRTIYLYPMALSMIVTGTAWKWLLNPGMGLDK 144 MF+ + +G+ +A++L+QK+ +++++ P LS +V G + W +P GL Sbjct: 102 LLMFL-LAPPMGLAIALYLNQKVIGMRVVKSLFFAPFVLSGVVVGLMYSWFYDPSFGLLS 160 Query: 145 LLRDWGWEGFRLDWLIDPDRVVYCLVIAAVWQASGFIMAMFLAGLRGVDQSIVRAAQIDG 204 LL G + L D + ++ AA+W + + M +FL GL ++ V AA+++G Sbjct: 161 LLFGQG-----VPVLGDARYATFGIIFAALWPQTAYCMILFLTGLTALNHDQVEAARMEG 215 Query: 205 ASMPRIYWSVVLPSLRPVFFSAVMILAHIAIKSFDLVAAMTAGGPGYSSDLPAMFMYSFT 264 A + V+LP LR F A ++ A++SFDL++ MT+GGP SS + A + Y Sbjct: 216 AKGWTMLRYVILPQLRSTTFMAFVVSIIGALRSFDLISVMTSGGPYESSTVLAYYAYDQA 275 Query: 265 FSRGQMGMGSASAILMLGAILAIIVPYLYSELRTKR 300 + G +A A+ + +L IV L LR +R Sbjct: 276 IKYYRQGYSAAVAVTLFAIMLVYIVYQLRRMLRAER 311 Lambda K H 0.330 0.141 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 311 Length adjustment: 27 Effective length of query: 275 Effective length of database: 284 Effective search space: 78100 Effective search space used: 78100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory