Align LacG, component of Lactose porter (characterized)
to candidate HSERO_RS18945 HSERO_RS18945 glycerol-3-phosphate transporter membrane protein
Query= TCDB::P29824 (273 letters) >FitnessBrowser__HerbieS:HSERO_RS18945 Length = 283 Score = 132 bits (332), Expect = 8e-36 Identities = 84/280 (30%), Positives = 134/280 (47%), Gaps = 12/280 (4%) Query: 6 RRRLPDIVQYSVLSLAAFLSIFPFIWMVIGTTNTTSQIIRGKVT----------FGTALF 55 RR + D + + VL L + FP + +T + Q ++ + T LF Sbjct: 4 RRPILDFLSHVVLVLGVLIVFFPLYVAFVASTQSAEQSALSPLSLAPGGEFMNNYSTVLF 63 Query: 56 DNIASFFAQVDVPLVFWNSVKIALVGTALTLLVSSLAGYGFEMFRSKLRERVYTVILLTL 115 A V + W S+ AL+ + +S L+ + FR R + +I +TL Sbjct: 64 KGAAGQVTAPPVLHMLWVSLATALIIAIGKISISMLSAFAIVYFRFPGRGLFFWMIFVTL 123 Query: 116 MVPFAALMIPLFMLMGQAGLLNTHIAIMLPMIASAFIIFYFRQASKAFPTELRDAAKVDG 175 M+P + P + ++ G+LN++ + +P+IASA F FRQ P EL +AA++DG Sbjct: 124 MLPVEVRITPTYQVVSDLGMLNSYAGLSVPLIASATATFLFRQFFLTVPDELAEAARIDG 183 Query: 176 LKEWQIFFYIYVPVMRSTYAAAFVIVFMLNWNNYLWPLIVLQSNDTKTITLVVSSLASA- 234 + + P+ R+ A FVI+F+ WN YLWPLI+ I + + +L S Sbjct: 184 AGPLRFLKDVLWPLSRTNVIALFVIMFIYGWNQYLWPLIIATDTSMYPIGIGIKTLISGG 243 Query: 235 -YSPEYGTVMIGTILATLPTLLVFFAMQRQFVQGMLGSVK 273 + E+ VM ILA LP LV MQ+ FV+G++ S K Sbjct: 244 DSAVEWNLVMATMILAMLPPGLVVVVMQKWFVKGLVDSEK 283 Lambda K H 0.331 0.140 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 283 Length adjustment: 25 Effective length of query: 248 Effective length of database: 258 Effective search space: 63984 Effective search space used: 63984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory