GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lacK in Herbaspirillum seropedicae SmR1

Align LacK, component of Lactose porter (characterized)
to candidate HSERO_RS22750 HSERO_RS22750 sugar ABC transporter ATP-binding protein

Query= TCDB::Q01937
         (363 letters)



>lcl|FitnessBrowser__HerbieS:HSERO_RS22750 HSERO_RS22750 sugar ABC
           transporter ATP-binding protein
          Length = 377

 Score =  363 bits (932), Expect = e-105
 Identities = 200/366 (54%), Positives = 254/366 (69%), Gaps = 8/366 (2%)

Query: 1   MAEVRLTDIRKSY-GSLEVIKGVNLEVSSGEFVVFVGPSGCGKSTLLRMIAGLEDISSGE 59
           MA V +  +RK+Y G  +V+ G+NL++  GEF V VGPSGCGKSTLLRM+ GLE+IS GE
Sbjct: 1   MAHVNIKQLRKTYDGRADVLAGLNLDIRDGEFCVLVGPSGCGKSTLLRMLCGLEEISGGE 60

Query: 60  LTIGGTVMNDVDPSKRGIAMVFQTYALYPHMTVRENMGFALRFAGMAKDEIERRVNAAAK 119
           L IGG V+N + P++RGIAMVFQ+YALYPHM V +NM F L+ AG +K +I+ R+  AA 
Sbjct: 61  LAIGGQVVNHLPPAERGIAMVFQSYALYPHMNVYKNMAFGLKVAGNSKSDIDARIRHAAA 120

Query: 120 ILELDALMDRKPKALSGGQRQRVAIGRAIVRQPDVFLFDEPLSNLDAELRVHMRVEIARL 179
           IL++D L+ R P+ LSGGQRQRVAIGRAIVRQP +FLFDEPLSNLDA LRV  R+EIA+L
Sbjct: 121 ILKIDHLLQRLPRELSGGQRQRVAIGRAIVRQPRLFLFDEPLSNLDAALRVQTRLEIAKL 180

Query: 180 HKELNATIVYVTHDQVEAMTLADKIVVMRGGIVEQVGAPLALYDDPDNMFVAGFIGSPRM 239
           H++L ATIVYVTHDQVEAMTL DKIVVM  G ++Q G PL LY  P N+FVAGFIGSP+M
Sbjct: 181 HRQLAATIVYVTHDQVEAMTLGDKIVVMHEGRIQQAGTPLELYQQPQNLFVAGFIGSPKM 240

Query: 240 NFLPAVVIGQAEGG-QVTVALKARPDTQLTVACATPPQGGDAVTVGVRPEHFLPAGSGDT 298
           NF   VV    + G QV +A   R    +     TP   G AVT+G+R E  +  G GD 
Sbjct: 241 NFFQGVVTRCDDSGVQVEIAGGLRLLADVDPLGVTP---GAAVTLGLRAEQ-IREGLGDG 296

Query: 299 Q-LTAHVDVVEHLGNTSYVYAHTVPGEQIIIEQEERRHGGRYGDEIAVGISAKTSFLFDA 357
           Q L   V++VEHLG  +++Y     G  I++  +  R+    G  IA+ + +    LFDA
Sbjct: 297 QPLHGVVNLVEHLGEANFLYVTLDGGHDIVVRGDGNRNVD-IGQPIALSVHSHAFHLFDA 355

Query: 358 SGRRIR 363
            G+ +R
Sbjct: 356 QGQALR 361


Lambda     K      H
   0.320    0.137    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 420
Number of extensions: 9
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 363
Length of database: 377
Length adjustment: 30
Effective length of query: 333
Effective length of database: 347
Effective search space:   115551
Effective search space used:   115551
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory