Align Succinyl-CoA:3-ketoacid coenzyme A transferase subunit A; Succinyl-CoA:3-oxoacid CoA-transferase; OXCT A; EC 2.8.3.5 (characterized)
to candidate HSERO_RS20000 HSERO_RS20000 3-oxoadipate CoA-transferase subunit A
Query= SwissProt::P56006 (232 letters) >FitnessBrowser__HerbieS:HSERO_RS20000 Length = 224 Score = 221 bits (563), Expect = 9e-63 Identities = 105/223 (47%), Positives = 159/223 (71%), Gaps = 2/223 (0%) Query: 1 MNKVITDLDKALSALKDGDTILVGGFGLCGIPEYAIDYIYKKGIKDLIVVSNNCGVDDFG 60 +NK+ L++A++ + DG TI++GGFG G+P ID + +G +DL +V+NN G + G Sbjct: 2 INKISDSLEQAVADIHDGATIMIGGFGNAGMPSALIDALIAQGARDLTIVNNNAGNGETG 61 Query: 61 LGILLEKKQIKKIIASYV--GENKIFESQMLNGEIEVVLTPQGTLAENLHAGGAGIPAYY 118 L LL+ K++KKI+ S+ ++++F++ +GEIE+ LTPQG LAE + A GAGI ++ Sbjct: 62 LAALLKTKRVKKIVCSFPRQSDSQVFDALYRSGEIELELTPQGNLAERIRAAGAGIGGFF 121 Query: 119 TPTGVGTLIAQGKESREFNGKEYILERAITGDYGLIKAYKSDTLGNLVFRKTARNFNPLC 178 +PTG GT++A+GKE+RE NG+ Y+LE I D+ LIKA + D GNLV+RKTARNF P+ Sbjct: 122 SPTGYGTMLAEGKETREINGRHYVLESPIHADFALIKALRGDRWGNLVYRKTARNFGPIM 181 Query: 179 AMAAKICVAEVEEIVPAGELDPDEIHLPGIYVQHIYKGEKFEK 221 AMAAK +A+V E+V G+LDP+ I PGI+VQ I + ++ ++ Sbjct: 182 AMAAKCTIAQVSEVVELGQLDPENIVTPGIFVQRIVQTKEAQQ 224 Lambda K H 0.317 0.140 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 224 Length adjustment: 23 Effective length of query: 209 Effective length of database: 201 Effective search space: 42009 Effective search space used: 42009 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory