Align acyl-CoA dehydrogenase subunit (EC 1.3.8.4; EC 1.3.8.5) (characterized)
to candidate HSERO_RS04640 HSERO_RS04640 butyryl-CoA dehydrogenase
Query= metacyc::MONOMER-11693 (386 letters) >FitnessBrowser__HerbieS:HSERO_RS04640 Length = 382 Score = 268 bits (685), Expect = 2e-76 Identities = 152/378 (40%), Positives = 225/378 (59%), Gaps = 5/378 (1%) Query: 5 LTPELEELRRTVEEFAHDVVAPKIGDFYERHEFPYEIVREMGRMGLFGLPFPEEYGGMGG 64 L+PE E +R + FA + + P D+ H FP E ++E+ +G G+ PE++GG G Sbjct: 3 LSPEHEMIRDAMRHFAQERLLPFAADWDRNHTFPAEALKELAELGAMGMCVPEQWGGAGM 62 Query: 65 DYLALGIALEELARVDSSVAITLEAGVSLGAMPIHLFGTDAQKAEWLPRLCSGEILGAFG 124 DY++L +ALEE+A D + + + SL +G+ QK +WL L GE+LG F Sbjct: 63 DYMSLVLALEEIAAGDGATSTIVSVQNSLACGITEKYGSPTQKEQWLKPLARGEMLGCFC 122 Query: 125 LTEPDGGSDAGATRTTARLDESTNEWVINGTKCFITNSGTDITGLVTVTAVTGRKPDGKP 184 LTEP GSDA A RT A D +++++NGTK FIT+ G+ V AVT R GK Sbjct: 123 LTEPHTGSDAAAIRTRAERDG--DDFILNGTKQFITSGKH--AGVAIVFAVTDRSA-GKK 177 Query: 185 LISSIIVPSGTPGFTVAAPYSKVGWNASDTRELSFADVRVPAANLLGEQGRGYAQFLRIL 244 IS +VP TPGF V K+G +ASDT ++ + RVPA LLG++G GY L L Sbjct: 178 GISCFLVPCDTPGFVVGRSEEKMGQHASDTVQIMLDNCRVPATALLGKEGEGYRIALSNL 237 Query: 245 DEGRIAISALATGLAQGCVDESVKYAGERHAFGRNIGAYQAIQFKIADMEMKAHMARVGW 304 + GRI I+A + G+A+ + +V YA +R +FG I +QA+ F++ADM AR+ Sbjct: 238 EAGRIGIAAQSVGMARAAFEAAVSYARQRESFGVPIIEHQAVNFRLADMNTLLDAARLMV 297 Query: 305 RDAASRLVAGEPFKKEAAIAKLYSSTVAVDNAREATQIHGGYGFMNEYPVARMWRDSKIL 364 AA G P KEA++AK+++S A A +A QIHGG G+ +++PV R++RD +I Sbjct: 298 WRAAQLKDQGRPCLKEASMAKMFASEAAEKIASDAIQIHGGVGYTSDFPVERIYRDVRIC 357 Query: 365 EIGEGTSEVQRMLIAREL 382 +I EG +++QR++I R + Sbjct: 358 QIYEGANDIQRLVIGRAI 375 Lambda K H 0.318 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 386 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 382 Length adjustment: 30 Effective length of query: 356 Effective length of database: 352 Effective search space: 125312 Effective search space used: 125312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory