GapMind for catabolism of small carbon sources

 

Aligments for a candidate for liuA in Herbaspirillum seropedicae SmR1

Align Putative acyl-CoA dehydrogenase AidB; EC 1.3.99.- (characterized)
to candidate HSERO_RS04905 HSERO_RS04905 acyl-CoA dehydrogenase

Query= SwissProt::P33224
         (541 letters)



>lcl|FitnessBrowser__HerbieS:HSERO_RS04905 HSERO_RS04905 acyl-CoA
           dehydrogenase
          Length = 550

 Score =  476 bits (1224), Expect = e-138
 Identities = 269/525 (51%), Positives = 330/525 (62%), Gaps = 11/525 (2%)

Query: 5   THTVFNQPIPLNNSNLYLSDGALCEAVTREGAGWDSDFLASIGQQLGTAESLELGRLANV 64
           TH + NQ   L+  NLY SD AL EAV REGA W    LAS G+ LG AE  E+  LAN 
Sbjct: 3   THEITNQVPDLSGYNLYRSDAALAEAVQREGAHWHDCTLASQGELLGGAEMREMAELANR 62

Query: 65  NPPELLRYDAQGRRLDDVRFHPAWHLLMQALCTNRVHNLAWEEDARSGAFVARAARFMLH 124
           + P L  +D  GRR+D V FHPAWH L+  L    +H L W +    GA  ARAA + LH
Sbjct: 63  HTPVLHTHDRCGRRIDVVEFHPAWHTLLDQLRRAGLHALPWMQPG-DGAHAARAAGYFLH 121

Query: 125 AQVEAGSLCPITMTFAATPLLLQMLPAPFQDWTTPLLSDRYDSHLLPGGQKRGLLIGMGM 184
           AQ+EAGSLCP TMTFAA  +L Q  PA F+   T L S  +D+  LP  QKR +LIGMGM
Sbjct: 122 AQIEAGSLCPTTMTFAAIAVL-QQEPALFEQLRTRLFSREHDARDLPIPQKRSILIGMGM 180

Query: 185 TEKQGGSDVMSNTTRA---ERLEDG---SYRLVGHKWFFSVPQSDAHLVLAQTAGGLSCF 238
           TEKQGGSDV SN + A   + L DG   +Y L GHKWFFS P  DAHL+LA+T  GLSCF
Sbjct: 181 TEKQGGSDVRSNASIAMPVDPLNDGRGAAYLLSGHKWFFSAPMCDAHLMLARTENGLSCF 240

Query: 239 FVPRFLPDGQRNAIRLERLKDKLGNRSNASCEVEFQDAIGWLLGLEGEGIRLILKMGGMT 298
           FVPR+LPDG RN I ++RLKDKLGNRSN+S EVEF++A+G ++G EG GI  I++M   T
Sbjct: 241 FVPRWLPDGTRNPILIQRLKDKLGNRSNSSSEVEFEEAMGIMVGDEGRGIPTIIEMANHT 300

Query: 299 RFDCALGSHAMMRRAFSLAIYHAHQRHVFGNPLIQQPLMRHVLSRMALQLEGQTALLFRL 358
           R DC +GS A+MR+A   AI+HA  R  FG  L +QPLMR VL+ +AL+ E  T L+ R+
Sbjct: 301 RLDCIIGSAALMRQALVQAIHHARHRSAFGRRLAEQPLMRAVLADLALESEAATMLMLRV 360

Query: 359 ARAWDRRADAKEALWARLFTPAAKFVICKRGMPFVAEAMEVLGGIGYCEESELPRLYREM 418
           A A+D   D  +  W R+ TPAAKF ICKR + F  E MEV GG GY E + + RLYRE 
Sbjct: 361 AHAFDAPDDPLQRAWKRIITPAAKFWICKRTLEFTGECMEVWGGNGYVETAPMARLYREA 420

Query: 419 PVNSIWEGSGNIMCLDVLRVLNKQAGVYDLLSEAFVEVKGQDRYFDRAVRRLQQQLRKPA 478
           PVNSIWEGSGN+MCLDVLR + ++     LL     +         + V  L+Q L  P 
Sbjct: 421 PVNSIWEGSGNVMCLDVLRAMARETQGLALLLLELDDAAAGHPALRQQVDALKQMLAAPE 480

Query: 479 EEL---GREITHQLFLLGCGAQMLKYASPPMAQAWCQVMLDTRGG 520
           EE     R +  QL L   G  ML++A    AQA+ +      GG
Sbjct: 481 EEREAGARRLVQQLVLALQGMLMLRHAPAGSAQAFLESRSQADGG 525


Lambda     K      H
   0.324    0.138    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 745
Number of extensions: 32
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 541
Length of database: 550
Length adjustment: 35
Effective length of query: 506
Effective length of database: 515
Effective search space:   260590
Effective search space used:   260590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory