GapMind for catabolism of small carbon sources

 

Aligments for a candidate for liuB in Herbaspirillum seropedicae SmR1

Align Methylcrotonoyl-CoA carboxylase (EC 6.4.1.4) (characterized)
to candidate HSERO_RS22345 HSERO_RS22345 urea carboxylase

Query= reanno::SB2B:6937189
         (673 letters)



>lcl|FitnessBrowser__HerbieS:HSERO_RS22345 HSERO_RS22345 urea
           carboxylase
          Length = 1207

 Score =  380 bits (976), Expect = e-109
 Identities = 226/528 (42%), Positives = 311/528 (58%), Gaps = 23/528 (4%)

Query: 1   MFNKLLIANRGEIACRVIRTARDMGIKTVAVYSDADRDARHVALADESFYLGESAPASSY 60
           MF+ LLIANRG IACR++RT R + +  V VYS+AD  + HV  AD +  LGE   A +Y
Sbjct: 1   MFDHLLIANRGAIACRILRTLRTLDVTGVCVYSEADLGSLHVLQADRAISLGEGPAAQTY 60

Query: 61  LRGELIIDIAKKCGAEAIHPGYGFLSENAAFARACEASGIAFVGPGSDAIDAMGSKSAAK 120
           L  + I+  A+  GA+AIHPGYGFLSENAAFA ACEA+GIAFVGP    +   G K  A+
Sbjct: 61  LAVDKILAAARDSGAQAIHPGYGFLSENAAFAEACEAAGIAFVGPTPAQLRIFGLKHTAR 120

Query: 121 LIMEKAGVPLVPGYHGDDQSDATLLAEAKKIGYPLLIKAAYGGGGKGMRIVESESELKAA 180
            +  + GVP++ G    +  D  L A A ++GYP+++K+  GGGG GMR+  S++EL  A
Sbjct: 121 ALAREQGVPMLEGTDLLESIDDALAA-ASRVGYPVMLKSTAGGGGIGMRVCRSDAELADA 179

Query: 181 IDSARREAASSFGNDKLLMERYLRQPRHVEVQVFADSQGNCVYLSDRDCSIQRRHQKVVE 240
            DS RR   ++F +  + +E+Y+ + RH+EVQVF D +G  + L  RDCS+QRR+QKV+E
Sbjct: 180 FDSVRRLGQNNFSDAGVFIEKYIERARHLEVQVFGDGRGEVIALGVRDCSVQRRNQKVLE 239

Query: 241 EAPAPGLPDSLRKQMGEAAVAAAKAIDYRGAGTVEFLLD-VDMSFFFMEMNTRLQVEHPV 299
           E PAP LPD + + +  AA+  AKA++YR AGTVEF+ D +   F+F+E+NTRLQVEH V
Sbjct: 240 ETPAPNLPDGMAEALCAAAIKLAKAVNYRSAGTVEFVYDSLAGQFYFLEVNTRLQVEHGV 299

Query: 300 TEMVTGQDLVKWQLLVAAGAQLPLEQ--HEIQIHGHAFEVRIYAEDPNNEFLPASGKLTF 357
           TE V G DLV+W + +AAG   PL Q    +Q  GHA + R+YAEDP  +F P  G LT 
Sbjct: 300 TEQVWGVDLVRWMIELAAGDLPPLAQLAAGLQPRGHAIQARLYAEDPGRQFQPCPGLLTA 359

Query: 358 LR-EPEPSRHVRIDSGVRENDVISNYYDPMIAKLIVWDESRPRALARLTRALGDYRVGGL 416
           +   P   + +RID+ V     I+ Y+DPMIAKLI W  +R  A   L  AL    + G+
Sbjct: 360 VDFPPVDGQALRIDTWVEAGCEIAPYFDPMIAKLISWQPTREAARLALDAALRATLLYGV 419

Query: 417 KHNIEFLSNIAEHPAFAQANFSTDFIGRYGDALIGDSRDEADTAFVLAVLTQLRLRE--- 473
           + N  +L  I     FA         G+     +      ADT  VLA  TQ  +++   
Sbjct: 420 ETNQHYLRQILADVPFAS--------GQPWTRCLEQLVYRADTVEVLAPGTQTTVQDHPG 471

Query: 474 AVSQDVAGHDPFSPWSSLKGFRLSSPRRHSVTLLDDAHQSRSAELTES 521
            +     G  P  P    +  RL +       LL +A ++   E+T S
Sbjct: 472 RIGYWAVGVPPSGPMDE-RALRLGN------RLLGNAEEAAGLEVTMS 512



 Score = 50.8 bits (120), Expect = 4e-10
 Identities = 32/97 (32%), Positives = 54/97 (55%), Gaps = 4/97 (4%)

Query: 568  FLSSGSYHFR-EVLGQVLEETASSED---KLKAPMNGTVVTHLVAAGDKVSAGQGLLVME 623
            +++SG  ++  E    + +E A  +D    + AP+ G +    V+ G +V+ G+ L+++E
Sbjct: 1104 WIASGQANYESEESSAIAQEAAPLQDGQMAVDAPIAGNLWQVKVSPGQRVAQGELLMILE 1163

Query: 624  AMKMEYTIEAPFDGVVSEFFFAPGELVSDGTLLLALE 660
            +MKME  I AP  GVV+E    PG  V  G  +L +E
Sbjct: 1164 SMKMEIHIAAPAAGVVAEVRVQPGSPVRAGQCVLVME 1200



 Score = 27.7 bits (60), Expect = 0.003
 Identities = 17/43 (39%), Positives = 21/43 (48%)

Query: 586  ETASSEDKLKAPMNGTVVTHLVAAGDKVSAGQGLLVMEAMKME 628
            E+   E  + AP  G V    V  G  V AGQ +LVME  + E
Sbjct: 1163 ESMKMEIHIAAPAAGVVAEVRVQPGSPVRAGQCVLVMEDTEEE 1205


Lambda     K      H
   0.317    0.134    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1746
Number of extensions: 83
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 3
Number of HSP's successfully gapped: 3
Length of query: 673
Length of database: 1207
Length adjustment: 43
Effective length of query: 630
Effective length of database: 1164
Effective search space:   733320
Effective search space used:   733320
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory