Align Methylglutaconyl-CoA hydratase, mitochondrial; AU-specific RNA-binding enoyl-CoA hydratase; AU-binding enoyl-CoA hydratase; muAUH; Itaconyl-CoA hydratase; EC 4.2.1.18; EC 4.2.1.56 (characterized)
to candidate HSERO_RS19405 HSERO_RS19405 enoyl-CoA hydratase
Query= SwissProt::Q9JLZ3 (314 letters) >FitnessBrowser__HerbieS:HSERO_RS19405 Length = 258 Score = 145 bits (365), Expect = 1e-39 Identities = 93/256 (36%), Positives = 145/256 (56%), Gaps = 10/256 (3%) Query: 59 EENRGIVVLGINRAYGKNALSKNLLKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADL 118 E + + ++ ++R NALS L+ L +A+ A + +++ III F AGAD+ Sbjct: 9 ETHEKVGLIRLHRPKALNALSDGLMTELGEALLAFDAQEEIGCIIITGSEKA-FAAGADI 67 Query: 119 KERAKMHSSEV--GPFVSKIRSVINDIANLPVPTIAAIDGLALGGGLELALACDIRVAAS 176 A +V G F+++ + I P IAA+ G ALGGG ELA+ CD +AA Sbjct: 68 SAMAGYDYMDVFKGEFITRNWETLRRIRK---PVIAAVAGYALGGGCELAMMCDFIIAAD 124 Query: 177 SAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGQEAKAVGLISHVLEQN 236 +AK G E KL I+PG GGTQRLPRA+ + A +L + R++D +EA+ GL+S ++ + Sbjct: 125 NAKFGQPEIKLGIVPGAGGTQRLPRAVSKAKAMDLALTGRMMDAEEAERAGLVSRIVAAD 184 Query: 237 QEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQGMEVDLVTGLAIEEACYAQTISTKDR 296 + + A A+ +A +P+ VAM V K ++N+ E L G+ E A + +T+D+ Sbjct: 185 KLLEEAMAAAIIIAE--MPR-QVAMMV-KDSVNRAYETTLSEGMKYERALFYSCFATEDQ 240 Query: 297 LEGLLAFKEKRPPRYK 312 EG+ AF EKR P +K Sbjct: 241 KEGMKAFLEKRQPVFK 256 Lambda K H 0.318 0.135 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 258 Length adjustment: 26 Effective length of query: 288 Effective length of database: 232 Effective search space: 66816 Effective search space used: 66816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory