Align ABC transporter substrate-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate HSERO_RS14690 HSERO_RS14690 amino acid ABC transporter periplasmic protein
Query= TCDB::Q8DQI1 (386 letters) >FitnessBrowser__HerbieS:HSERO_RS14690 Length = 385 Score = 164 bits (416), Expect = 3e-45 Identities = 112/333 (33%), Positives = 168/333 (50%), Gaps = 19/333 (5%) Query: 41 IKIGFNFEESGSLAAYGTAEQKGAQLAVDEINAAGGIDGKQIEVVDKDNKSETAEAASVT 100 IK+G +G A YG A + G LA +EINA GG++G ++ +V +D + + EA +V Sbjct: 28 IKLGVAEALTGPAAKYGVAIKNGFTLASEEINAKGGVNGDKLALVIEDEQGKKEEAINVF 87 Query: 101 TNLVTQSKVSAVVGPATSGATAAAVANATKAGVPLISPSATQDGLTKGQDYLFIGTFQDS 160 L+ Q KV AV GP S + AA A A V + S T DG+T + F + ++ Sbjct: 88 KKLIFQDKVLAVFGPTLSNSAFAADPIANAAKVVVFGTSNTADGITAMGPFTFRNSVMEA 147 Query: 161 FQGKIISNYVSEKLNAKKVVLYTDNASDYAKG---IAKSFRESYKGEIVADETFVAGDTD 217 + + KKV + N + K + K+ E K + E + GD D Sbjct: 148 DVLPVTVKAAVKHFGIKKVAVIYGNDDAFTKSGYDVFKATLEHQKIPVTTTEAYAKGDVD 207 Query: 218 FQAALTKMKGKDFDAIVVPGYYNEAGKIVNQARGMGIDKPIVGGDGFNGEEFVQQATAEK 277 F+A LTK+K + DAIV EA I+ Q R +G+ +P +GG+G N + + A + Sbjct: 208 FKAQLTKIKAGNPDAIVCSCLAEEAANIILQTRALGMKQPFIGGNGLNSPKLFEIA-KDA 266 Query: 278 ASNIYFISGFSTTVEVSAKAKAFLDAYRAKYNEEPSTFAALAYDSVHLVANAAKGAKNSG 337 N S +S + A KAF+ AY+AK+ +P FAA AYD++++VA+A K K SG Sbjct: 267 GDNTLMGSPWSAENQTPAN-KAFITAYKAKFGADPDQFAAQAYDAMYIVADALKNVKLSG 325 Query: 338 EIKNNLAKTKD----------FEGVTGQTSFDA 360 NLAK +D +G TG+ +F A Sbjct: 326 ----NLAKDRDALRAALPAVKIDGATGKFAFRA 354 Lambda K H 0.310 0.126 0.337 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 341 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 385 Length adjustment: 30 Effective length of query: 356 Effective length of database: 355 Effective search space: 126380 Effective search space used: 126380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory