GapMind for catabolism of small carbon sources

 

Aligments for a candidate for amaA in Herbaspirillum seropedicae SmR1

Align pipecolate oxidase (EC 1.5.3.7) (characterized)
to candidate HSERO_RS05840 HSERO_RS05840 FAD-dependent oxidoreductase

Query= metacyc::G1G01-5614-MONOMER
         (432 letters)



>lcl|FitnessBrowser__HerbieS:HSERO_RS05840 HSERO_RS05840
           FAD-dependent oxidoreductase
          Length = 433

 Score =  243 bits (621), Expect = 6e-69
 Identities = 147/416 (35%), Positives = 210/416 (50%), Gaps = 8/416 (1%)

Query: 13  LWEHVSKPTVAAQALAGEHKADVCVIGGGITGLSAAIHLLEQGKSVIVLEAWKIGHGGSG 72
           LW   +     A  L    + DV ++G G TGLS A+HL + G SV VL+A   G G SG
Sbjct: 13  LWAATAGEFSGAPPLQASARYDVAIVGAGYTGLSTALHLAQAGVSVCVLDAHAPGWGASG 72

Query: 73  RNVGLVNAGTWIRPDDVEATLGQKQGSRLNKVLGEAPAEVFAMIERLGIDCQAQHKGTLH 132
           RN G V  G    PD +    G      L   +G A   VF +I R GI+C+AQ  G + 
Sbjct: 73  RNGGQVIPGLKYDPDQLRVMFGSAVADPLIAAIGSAADTVFDLIARHGIECEAQRAGWIQ 132

Query: 133 MAHNATGIADLEARHEQWRRRGADVELLTGAQCQEYCGTDKISAALLDRRAGTINPMGYT 192
             H+   +  LEAR  QW   GA  +L+ GA+     GT        D RAG+++P+ Y 
Sbjct: 133 PTHSPKMMRALEARARQWMAEGAPAQLMDGAEVTRRIGTGAYVGGWKDERAGSLHPLKYC 192

Query: 193 QGLAAAVTRLGGKIFQQSSVEGLEREGDGWRVKTARGA----VRAEKVVISTGAYTEGDW 248
           +GLA A  RLG  I   + V  LER   GWR+    G     + AE+VV++T  YT+  W
Sbjct: 193 RGLAQAAQRLGVVIHGDTRVTRLERRQGGWRLHGPSGEQGPHIDAERVVLATNGYTDDLW 252

Query: 249 SNLQKQFFRGYYYQVASKPLQGIAADKVLPHGQGSWDTRTVLSSIRRDDQGRLLLGSLGR 308
            +L++       + VA++PL       +LP G+ + D+R +L   RRD QGRLL+G  G 
Sbjct: 253 PHLRQSVIAANSFIVATRPLPPALGASILPGGEVTSDSRRLLLYYRRDAQGRLLMGGRGP 312

Query: 309 VDNK--PAWFVRSWADRIQSHYYPELGKVEWEMHWTGCIDFTPDHLMRLFEPAPGLVAVT 366
                 PA F     +R  +  +P+L  VE+E  W+G +  T D L  + EPAPGL    
Sbjct: 313 FGEPQGPADFAH--LERSVALLFPQLAGVEYEYRWSGRVAITRDFLPHVHEPAPGLSIAL 370

Query: 367 GYNGRGNTTGTVIGRAFAEFLLKGEADSLPIPFSPMSGVSAPSLRTAFYESGFSLY 422
           GYNGRG    T++G+  A+ L+     + P P S ++ +    L+  +  +G + Y
Sbjct: 371 GYNGRGIAMATMMGQRLAQRLIGPAGTAFPFPVSTIAPIPLHGLQRFYIAAGVAWY 426


Lambda     K      H
   0.319    0.135    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 516
Number of extensions: 29
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 432
Length of database: 433
Length adjustment: 32
Effective length of query: 400
Effective length of database: 401
Effective search space:   160400
Effective search space used:   160400
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory