Align Putative amino-acid binding periplasmic protein (characterized, see rationale)
to candidate HSERO_RS17550 HSERO_RS17550 amino acid ABC transporter substrate-binding protein
Query= uniprot:Q92PA9 (260 letters) >FitnessBrowser__HerbieS:HSERO_RS17550 Length = 249 Score = 124 bits (310), Expect = 2e-33 Identities = 78/241 (32%), Positives = 131/241 (54%), Gaps = 9/241 (3%) Query: 13 AAVFVLMAGVAMAEGEKVVIGTEGAYPPFNNLESDGTLTGFDIDIAKALCEEMKAECTFV 72 A++ L A A E +V+ + A+ PF + GFDID+ A+ +++ Sbjct: 11 ASLVALSVVGASARAETLVVACDTAFVPFE-FKDRNQYVGFDIDLWDAIAKDIGVTYKLQ 69 Query: 73 TQDWDGIIPALIAKKFDAIVASMSITEERKQQVDFTNKYYNTPPAIVVPKDSPITEATAA 132 D++GIIPAL K D +A ++I +ERK+ +DF++ YY++ +++VP S I + A Sbjct: 70 PMDFNGIIPALQTKNVDVALAGITIKDERKKVIDFSDGYYDSGFSLMVPVGSSI--KSVA 127 Query: 133 ALSGKALGAQGSTTHSNYAEAHMKESEVKLYPTADEYKLDLANGRIDAAIDDVVVLSEWL 192 L+GKAL + T+ +YA+A+ K +E+ +P D L+L GR+DAA+ D + ++ Sbjct: 128 DLAGKALAVKSGTSAFDYAKANFKATELHQFPNIDNAYLELQTGRVDAAMHDTPNVLYYI 187 Query: 193 KTEDGACCKLLGTLPIDPVINGEGAGIAIRKGDDALREKLNKAIEAIRANGKYKQINEKY 252 T K++GT + GI KG L K+N A+ I+A+G+Y +I K+ Sbjct: 188 ATAGKGRAKVVGT-----QMMAHQYGIGFPKG-SPLVPKVNAALAKIKADGRYAEIYRKW 241 Query: 253 F 253 F Sbjct: 242 F 242 Lambda K H 0.315 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 249 Length adjustment: 24 Effective length of query: 236 Effective length of database: 225 Effective search space: 53100 Effective search space used: 53100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory