Align lysine decarboxylase (EC 4.1.1.18) (characterized)
to candidate HSERO_RS16435 HSERO_RS16435 LOG family protein
Query= BRENDA::A0A2Z4EVE5 (218 letters) >FitnessBrowser__HerbieS:HSERO_RS16435 Length = 198 Score = 180 bits (456), Expect = 2e-50 Identities = 83/184 (45%), Positives = 126/184 (68%) Query: 13 RRICVFCGSSQGKKTSYQEAAIELGKELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHVI 72 + ICV+CGSS G +Y EAA +L +E+V+ NI LVYGGG++GLMG+++ V G Sbjct: 2 KSICVYCGSSPGASPAYAEAARKLAREMVNNNIALVYGGGNVGLMGIIASEVMQLGGEAT 61 Query: 73 GVIPKTLMPRELTGETVGEVKAVADMHQRKAEMARHSDAFIALPGGYGTLEELLEVITWA 132 GVIPK L+ +EL + + + V DMH+RKA MA SD F+A+PGG GTLEEL EV+TWA Sbjct: 62 GVIPKALLDKELGHDGLTRLHIVKDMHERKAMMAELSDGFVAMPGGMGTLEELFEVLTWA 121 Query: 133 QLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPSARHIIVSAPTAKELVKKLEEYVP 192 QLG H KP+ L NV+G+Y++L++F+D V + F+S +++ L+++ + + P Sbjct: 122 QLGFHYKPICLYNVNGFYDNLIAFVDHLVSQRFVSSDQSGLMMHEADPARLIQRFQTFTP 181 Query: 193 SHES 196 ++++ Sbjct: 182 TYKT 185 Lambda K H 0.316 0.134 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 218 Length of database: 198 Length adjustment: 21 Effective length of query: 197 Effective length of database: 177 Effective search space: 34869 Effective search space used: 34869 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory