Align Delta(1)-pyrroline-2-carboxylate/Delta(1)-piperideine-2-carboxylate reductase; Pyr2C/Pip2C reductase; EC 1.5.1.1 (characterized)
to candidate HSERO_RS00880 HSERO_RS00880 ornithine cyclodeaminase
Query= SwissProt::V5YW53 (311 letters) >FitnessBrowser__HerbieS:HSERO_RS00880 Length = 312 Score = 221 bits (562), Expect = 2e-62 Identities = 136/308 (44%), Positives = 172/308 (55%), Gaps = 11/308 (3%) Query: 9 VFDAADTAALLAYPALLATLGQAVADYAAGEIVSPERLVVPLQAGGVMLSMPSSARDLAT 68 + D TA L Y AL+ L +A + A G I +PER VVP+ A V+L MP+ A DL+ Sbjct: 3 ILDPRQTAQALPYAALVDALARATQELADGRIRAPERQVVPIDAASVLLGMPAIADDLSV 62 Query: 69 HKLVNVCPGNGARGLPTILGQVTAYDASTGEMRFALDGPTVTGRRTAAVTALGIQALHGA 128 KL+ V N LP I G+V A++ TG +DGPTVT RRTAA++ LGI+ L Sbjct: 63 TKLITVHADNARHQLPAIQGEVIAFETQTGRRLALMDGPTVTARRTAAMSMLGIRTLLPR 122 Query: 129 APRDILLIGTGKQAANHAEALAAIFPEARLHVRGTSADSAAAFCAAHRAQAPRLV--PLD 186 P+ LLIGTG Q+A HA+AL F + + AFC A + P+ V PL Sbjct: 123 QPQSALLIGTGVQSAAHADALVEFFGVRQFWIVARDLARTQAFCRALSERHPQAVASPLP 182 Query: 187 GDAIPDAI---DVVVTLTTSRTPVYREAAREGRLVVGVGAFTADAAEIDANTVRASRLVV 243 + + DVV+ LTTSR+ V E L +GVGAF D E A+ + A R+VV Sbjct: 183 AQMLQQDLPHTDVVIALTTSRSAVIPEHIAADTLAIGVGAFKPDMVEFPASLLHARRIVV 242 Query: 244 DDPAGARHEAGDLIVAQVDWQHVASLADVLGGTFD----RSGPLL--FKSVGCAAWDLAA 297 DD AGA HEAGDLI A VDW V ++ADV+ G SG L FK+VG AAWDLAA Sbjct: 243 DDLAGAHHEAGDLIQAGVDWSGVVAIADVVAGRAPAAALASGAALPVFKTVGQAAWDLAA 302 Query: 298 CRTARDAL 305 R R L Sbjct: 303 ARVMRATL 310 Lambda K H 0.320 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 311 Length of database: 312 Length adjustment: 27 Effective length of query: 284 Effective length of database: 285 Effective search space: 80940 Effective search space used: 80940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory