Align Amino acid ABC transporter, membrane protein (characterized, see rationale)
to candidate HSERO_RS19340 HSERO_RS19340 amino acid ABC transporter permease
Query= uniprot:Q88GX3 (239 letters) >FitnessBrowser__HerbieS:HSERO_RS19340 Length = 216 Score = 101 bits (251), Expect = 1e-26 Identities = 68/213 (31%), Positives = 101/213 (47%), Gaps = 12/213 (5%) Query: 19 LLAGALVTVSLALACLPIGLPLGLVVALAARSRKRLPRAWATTFSTVFRGLPELLTLLII 78 LL A+ TV L+L G G V+AL S + R A+ + V +G+P L+ L + Sbjct: 12 LLQAAVWTVVLSLVAFVFGGVAGFVIALWRVSPNAVLRGIASGYIQVVQGIPLLVILFVA 71 Query: 79 YYGCQIAAQKILAAMGYQGEFLINTFLAAMIAFSLVFAAFSSEIWLAAFKTLPKGQLEAC 138 Y+G IA F + +AA I+F++ AAF EIW + +PK Q EA Sbjct: 72 YFGLAIAG------------FKLTPLVAAGISFAIYCAAFLGEIWRGCIQAVPKTQWEAS 119 Query: 139 SALGLSKRTGFFKVLLPQLTRIALPGLSNNWLSLLKDTSLVSTISLVDLMRQTNLAVSVT 198 LG ++ KV+LPQ +IA P + ++K+TSL S I VDL R + + T Sbjct: 120 ECLGFNRFEQLTKVILPQAVKIATPPTVGFMVQIVKNTSLASVIGFVDLSRAGQIINNST 179 Query: 199 KEPMFFYGVACLGYLLFAALSGRVFAYIERRSN 231 +P +G L Y + + ER+ N Sbjct: 180 FQPFTVFGCVALIYFCLCFPLSALSKHFERKLN 212 Lambda K H 0.328 0.139 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 120 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 239 Length of database: 216 Length adjustment: 22 Effective length of query: 217 Effective length of database: 194 Effective search space: 42098 Effective search space used: 42098 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory