GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lat in Herbaspirillum seropedicae SmR1

Align Ornithine aminotransferase; Orn-AT; Lysine aminotransferase; Lys-AT; EC 2.6.1.13; EC 2.6.1.36 (characterized)
to candidate HSERO_RS05420 HSERO_RS05420 4-aminobutyrate aminotransferase

Query= SwissProt::Q5JEW1
         (445 letters)



>lcl|FitnessBrowser__HerbieS:HSERO_RS05420 HSERO_RS05420
           4-aminobutyrate aminotransferase
          Length = 426

 Score =  259 bits (662), Expect = 1e-73
 Identities = 148/408 (36%), Positives = 229/408 (56%), Gaps = 17/408 (4%)

Query: 41  ERGEGIRVYDVDGNVFYDFASGVGVINVGHSHPRVVEAIKKQAEKFTHYSLTDFFYENAI 100
           ER     ++DV+G  F DFA+G+ V+N GH HP++++A++ Q +KFTH +     Y + +
Sbjct: 31  ERAANAELWDVEGRRFIDFAAGIAVLNTGHRHPKLLDAMRAQMDKFTHTAYQIVPYASYV 90

Query: 101 ILAEKLIELAPGDIERKVVYGNSGAEANEAAMKLVKYGTGRKQFLAFYHAFHGRTQAVLS 160
            LAE++  L PG+  +K  + ++GAEA E A+K+ +  TGR   +AF   FHGRT   ++
Sbjct: 91  ELAERINRLTPGNYPKKTAFFSTGAEAVENAIKIARAHTGRPGVIAFAGGFHGRTMMGMA 150

Query: 161 LTASKWVQQDGFFPTMPGVTHIPYPNPYRNTWGIDGYEEPDELTNRVLDFIEEYVFRHVP 220
           LT      + GF P    V H PYP+       + G    D      L+ ++      + 
Sbjct: 151 LTGKVAPYKLGFGPFPGDVFHAPYPS------ALHGITSED-----ALEAVKGLFKSDIE 199

Query: 221 PHEIGAIFFEPIQGEGGYVVPPKGFFKALKKFADEYGILLADDEVQMGIGRTGKFWAIEH 280
              + AI  EP+QGEGG+   P  F + L+   DE+GILL  DEVQ G GRTGK +A+EH
Sbjct: 200 AKRVAAIILEPVQGEGGFYAAPADFMRGLRALCDEHGILLIADEVQSGYGRTGKLFAMEH 259

Query: 281 FGVEPDLIQFGKAIGGGLPLAGVIHRADI-TFDKPGRHATTFGGNPVAIAAGIEVVEIVK 339
           + V PDL+   K++ GG+PL+ V  RA+I     PG    T+ GNP+AIA+ + V+++++
Sbjct: 260 YDVLPDLMTMAKSLAGGMPLSAVNGRAEIMDAPAPGGLGGTYAGNPLAIASALAVLDVME 319

Query: 340 E--LLPHVQEVGDYLHKYLEEFKEKYEVIGDARGLGLAQAVEIVKSKETKEKYPELRDRI 397
           E  L+   Q +GD L ++L+E +     I + RG+G   AVE      T +   E   ++
Sbjct: 320 EEQLVTRGQRLGDKLQEHLKELRSSVPQIAEVRGVGAMVAVEFA-DPATGKPDAEYTKKV 378

Query: 398 VKESAKRGLVLLGCGD--NSIRFIPPLIVTKEEIDVAMEIFEEALKAA 443
            + +   GL+LL CG   N IRF+ PL +    +D A+ I  +A++ A
Sbjct: 379 QQHALNNGLLLLTCGSYGNVIRFLFPLTIPDTVMDEALGILAKAIRLA 426


Lambda     K      H
   0.320    0.141    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 538
Number of extensions: 28
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 445
Length of database: 426
Length adjustment: 32
Effective length of query: 413
Effective length of database: 394
Effective search space:   162722
Effective search space used:   162722
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory