Align Maltose-transporting ATPase (EC 3.6.3.19) (characterized)
to candidate HSERO_RS16725 HSERO_RS16725 ABC transporter permease
Query= reanno::psRCH2:GFF850 (521 letters) >FitnessBrowser__HerbieS:HSERO_RS16725 Length = 299 Score = 95.9 bits (237), Expect = 2e-24 Identities = 75/245 (30%), Positives = 115/245 (46%), Gaps = 15/245 (6%) Query: 267 FTGFANFSRVLTEPSIREPFMQIFAWTFAFAGLTVVFTLAVGLVLASLLQWELVRGKAFY 326 F G NF+ L S+ + + +F F +++ +GL LA LL + V K F+ Sbjct: 51 FIGLDNFT-YLAGDSLAQ--LSLFNTVFYTVSASIL-KFMLGLWLAILLN-KNVPLKTFF 105 Query: 327 RLMLILPYAVPGFISILVFRGLFNQNFGEINLLLE--GLFGIRPDWFSDPSLARTMILIV 384 R +++LP+ VP +S L F L++ F I+ L GL D+ DP AR + Sbjct: 106 RAIVLLPWIVPTALSALAFWWLYDAQFSVISWALHKMGLIDRYIDFLGDPWNARWSTVFA 165 Query: 385 NTWLGYPYMLLLCMGLLQAIPRDQYEASAIDGASPLDNLLRITLPQLIKPLMPLLIACFA 444 N W G P++ + + LQ I YEA+AIDGA+P +TLP L + ++ Sbjct: 166 NVWRGIPFVAISLLAGLQTISPSLYEAAAIDGATPWQQFRHVTLPLLTPIIAVVMTFSVL 225 Query: 445 FNFNNFVLITLLTRGGPDIIGATTPAGTTDLLVSYTYRIAFQDSGQDFALAAAIATMIFI 504 F F +F LI +LTRGG P T L+ + +++ A A A + F+ Sbjct: 226 FTFTDFQLIYVLTRGG--------PLNATHLMATLSFQRAIPGGALGEGAALATYMIPFL 277 Query: 505 LVGAM 509 L M Sbjct: 278 LAAIM 282 Score = 28.1 bits (61), Expect = 5e-04 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 4/60 (6%) Query: 72 NRRMYAQRYIFPSVAGMLVFVIFPLLYTVGIGFTNYSGTNLLSQAQVERYHLSQTYLAGE 131 NR + ++ P+V ++VF+ +PL + +GFT+ S ++ + TYLAG+ Sbjct: 8 NRNVLGMLFMAPAVILLVVFLTYPLGLGIWLGFTDTKIGGEGSFIGLDNF----TYLAGD 63 Lambda K H 0.327 0.142 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 521 Length of database: 299 Length adjustment: 31 Effective length of query: 490 Effective length of database: 268 Effective search space: 131320 Effective search space used: 131320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory