Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate HSERO_RS16725 HSERO_RS16725 ABC transporter permease
Query= uniprot:C8WUR0 (321 letters) >FitnessBrowser__HerbieS:HSERO_RS16725 Length = 299 Score = 133 bits (335), Expect = 5e-36 Identities = 90/282 (31%), Positives = 153/282 (54%), Gaps = 18/282 (6%) Query: 27 YLSPALVTICVLSILPIFYTIYISFTNFNQMHFLSYQFVGLKNYEELLNPHDPLSNLFLP 86 +++PA++ + V P+ I++ FT+ S F+GL N+ L D L+ L L Sbjct: 16 FMAPAVILLVVFLTYPLGLGIWLGFTDTKIGGEGS--FIGLDNFTYLAG--DSLAQLSLF 71 Query: 87 TFIWTLVYALCTTALAYLVGLFLAVLLNNKHMRERTLYRTLLIVPWAVPNLISMLAWQGL 146 T+ Y + + L +++GL+LA+LLN K++ +T +R ++++PW VP +S LA+ L Sbjct: 72 N---TVFYTVSASILKFMLGLWLAILLN-KNVPLKTFFRAIVLLPWIVPTALSALAFWWL 127 Query: 147 LNDQYGQINALLHGVFGLPR-IPWLTSALWARIAVIMVNVWAGFPYMMTVCLGALQSIPT 205 + Q+ I+ LH + + R I +L AR + + NVW G P++ L LQ+I Sbjct: 128 YDAQFSVISWALHKMGLIDRYIDFLGDPWNARWSTVFANVWRGIPFVAISLLAGLQTISP 187 Query: 206 DQYEAAEIDGANWWQVFRYVTMPSVWRISLPLLIPSFSYNFNNFNASYLLTGGGPPNSNN 265 YEAA IDGA WQ FR+VT+P + I ++ S + F +F Y+LT GGP N+ Sbjct: 188 SLYEAAAIDGATPWQQFRHVTLPLLTPIIAVVMTFSVLFTFTDFQLIYVLTRGGPLNA-- 245 Query: 266 PFLGQTDILATAAYKMTLTFNRYDLGATISVLL--FILVALI 305 T ++AT +++ + GA ++ + F+L A++ Sbjct: 246 -----THLMATLSFQRAIPGGALGEGAALATYMIPFLLAAIM 282 Lambda K H 0.327 0.140 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 343 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 299 Length adjustment: 27 Effective length of query: 294 Effective length of database: 272 Effective search space: 79968 Effective search space used: 79968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory