Align ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) (characterized)
to candidate HSERO_RS16725 HSERO_RS16725 ABC transporter permease
Query= BRENDA::P68183 (296 letters) >FitnessBrowser__HerbieS:HSERO_RS16725 Length = 299 Score = 66.2 bits (160), Expect = 8e-16 Identities = 46/131 (35%), Positives = 65/131 (49%), Gaps = 17/131 (12%) Query: 125 MLIFQMFPAVLSLVALYALFDR--------------LGEYIPFIG--LNTHGGVIFAYLG 168 +L+ + P LS +A + L+D + YI F+G N +FA + Sbjct: 109 VLLPWIVPTALSALAFWWLYDAQFSVISWALHKMGLIDRYIDFLGDPWNARWSTVFANVW 168 Query: 169 -GIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAI 227 GI ++ +TI SL EAAA+DGATPWQ FR V LPL PI+AVV S + Sbjct: 169 RGIPFVAISLLAGLQTISPSLYEAAAIDGATPWQQFRHVTLPLLTPIIAVVMTFSVLFTF 228 Query: 228 TEVPVASLLLR 238 T+ + +L R Sbjct: 229 TDFQLIYVLTR 239 Lambda K H 0.328 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 299 Length adjustment: 26 Effective length of query: 270 Effective length of database: 273 Effective search space: 73710 Effective search space used: 73710 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory