Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate HSERO_RS17020 HSERO_RS17020 sugar ABC transporter ATP-binding protein
Query= BRENDA::Q70HW1 (384 letters) >FitnessBrowser__HerbieS:HSERO_RS17020 Length = 406 Score = 337 bits (863), Expect = 5e-97 Identities = 179/373 (47%), Positives = 249/373 (66%), Gaps = 14/373 (3%) Query: 1 MARVLLEHIYKTYPGQTEPTVKDFNLDIQDKEFTVFVGPSGCGKTTTLRMIAGLEDITEG 60 MA + + + K Y G P + +L I D EF V +GPSGCGK+T LRMIAGLEDI+ G Sbjct: 1 MADIHCQALAKHYAGGP-PVLHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGG 59 Query: 61 NLYIGDRRVNDVPPKDRDIAMVFQNYALYPHMTVYQNMAFGLKLRKVPKAEIDRRVQEAA 120 L IG VND+P ++R++AMVFQNYALYPHM+VY N+AFGL+ K P AEIDRRV+E A Sbjct: 60 TLRIGGTVVNDLPARERNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVA 119 Query: 121 KILDIAHLLDRKPKALSGGQRQRVALGRAIVREPQVFLMDEPLSNLDAKLRVQMRAEIRK 180 +L++ LL+RKP+A+SGGQ+QR A+ RAI++ P VFL DEPLSNLDAKLR Q+R +I++ Sbjct: 120 ALLNLEALLERKPRAMSGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKR 179 Query: 181 LHQRLQTTVIYVTHDQTEAMTMGDRIVVMRDGVIQQADTPQVVYSQPKNMFVAGFIGSPA 240 LHQRL+TT +YVTHDQ EAMT+ DR+++M+DG I QA +P +Y P+N+F AGFIG+PA Sbjct: 180 LHQRLRTTTVYVTHDQLEAMTLADRVILMQDGRIVQAGSPAELYRYPRNLFAAGFIGTPA 239 Query: 241 MNFIRGEIVQDGDAFYFRAPSISLRLPEGRYGVLKASGAIGKPVVLGVRPEDL----HDE 296 MNF+ G + + + L R+ L+ + A V L VRP+ + E Sbjct: 240 MNFLSGTVQRQDGQLFIETAHQRWALTGERFSRLRHAMA----VKLAVRPDHVRIAGERE 295 Query: 297 EVFMTTYPDSVLQMQVEVVEHMGSEVYLHTSIGPNTIVARVNPRHVYHVGSSVKLAIDLN 356 T P + VE+VE +G++ L T G T+ A V + G+++ LA+D + Sbjct: 296 PAASLTCP-----VSVELVEILGADALLTTRCGDQTLTALVPADRLPQPGATLTLALDQH 350 Query: 357 KIHIFDAETEESI 369 ++H+FD E+ E++ Sbjct: 351 ELHVFDVESGENL 363 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 468 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 406 Length adjustment: 31 Effective length of query: 353 Effective length of database: 375 Effective search space: 132375 Effective search space used: 132375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory