Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate HSERO_RS16715 HSERO_RS16715 sugar ABC transporter ATP-binding protein
Query= BRENDA::Q8NMV1 (376 letters) >FitnessBrowser__HerbieS:HSERO_RS16715 Length = 361 Score = 314 bits (804), Expect = 3e-90 Identities = 179/359 (49%), Positives = 232/359 (64%), Gaps = 23/359 (6%) Query: 21 VKKFNLEIADGEFLVLVGPSGCGKSTTLRMLAGLENVTDGAIFIGDKDVTHVAPRDRDIA 80 ++ +++IADGEF VLVGPSGCGKST LRMLAGLE +T G I IG V +V P+DRDIA Sbjct: 19 IRGVDIDIADGEFTVLVGPSGCGKSTLLRMLAGLEEITGGEILIGGTVVNNVQPKDRDIA 78 Query: 81 MVFQNYALYPHMTVGENMGFALKIAGKSQDEINKRVDEAAATLGLTEFLERKPKALSGGQ 140 MVFQNYALYPHMTV +NM F+L +A K + +++RV +AA LGL + L+R P+ LSGGQ Sbjct: 79 MVFQNYALYPHMTVRDNMAFSLTLAKKDKAFVDERVKKAADILGLNQLLDRYPRQLSGGQ 138 Query: 141 RQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAALQRKLGVTTVYVTHDQTEAL 200 RQRVAMGRAIVR+PQVFL DEPLSNLDAKLRVQ RT+I L ++L T++YVTHDQ EA+ Sbjct: 139 RQRVAMGRAIVRDPQVFLFDEPLSNLDAKLRVQMRTEIKELHQRLKTTSIYVTHDQIEAM 198 Query: 201 TMGDRIAVLKDGYLQQVGAPRELYDRPANVFVAGFIGSPAMNLGTFSVKDGDATSGHARI 260 TM D+I V++DG ++Q G P +LYD PAN+FVAGFIGSPAMN +++ +AT Sbjct: 199 TMADQIVVMRDGLVEQRGRPLDLYDYPANLFVAGFIGSPAMNFIPATLR-RNATGAEVEF 257 Query: 261 ----KLSPETLAAMTPEDNGRITIGFRPEALEIIPEGESTDLSIPIKLDFVEELGSDSFL 316 ++ AA+ D ++T G RPE L I G+ I K+ VE G+D+ + Sbjct: 258 ADGTRVPAPYGAALQGNDGQKVTYGVRPEHLSIGAAGQ----GIATKVIVVEPTGADTEV 313 Query: 317 YGKLVGEGDLGSSSEDVPESGQIVVRAAPNAAPAPGSVFHARIVEGGQHNFSASTGKRL 375 + + G+ L S + + G G V H H F A +GK L Sbjct: 314 FSRF-GDTSLTSIFRERHDFG-------------AGDVIHLVPDHSRTHLFDAESGKSL 358 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 361 Length adjustment: 30 Effective length of query: 346 Effective length of database: 331 Effective search space: 114526 Effective search space used: 114526 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory