Align Beta-phosphoglucomutase; Beta-PGM; EC 5.4.2.6 (characterized)
to candidate HSERO_RS00780 HSERO_RS00780 sugar transferase
Query= SwissProt::O06995 (226 letters) >FitnessBrowser__HerbieS:HSERO_RS00780 Length = 215 Score = 56.6 bits (135), Expect = 4e-13 Identities = 53/192 (27%), Positives = 79/192 (41%), Gaps = 21/192 (10%) Query: 4 VIFDLDGVITDTAEYHFLAWKHIAEQIDIPFD-RDMNERLKGISREESLESILIFGGAET 62 VIFD DG + D+ AW + D R +G+S + + G Sbjct: 11 VIFDCDGTLVDSEVVAARAWSEYVATYGVQLTPEDALARFRGVSMSWCIAHVAQLRG--- 67 Query: 63 KYTNAEKQELMHRKNRDYQMLISKLTPEDLLPGIGRLLCQLKNENIKIGLASSSRNAPK- 121 Q L ++ + + + + L P I L ++ I LAS NAP Sbjct: 68 -------QALPAHFEQELRARMGVMLEQHLQP-INGALEMVEQLQIPFALAS---NAPHH 116 Query: 122 ----ILRRLAIIDDFHA-IVDPTTLAKGKPDPDIFLTAAAMLDVSPADCAAIEDAEAGIS 176 LR ++ FH I + + KPDP +FL AA L V PA CA +ED+ G+ Sbjct: 117 KIELCLRVTGLLPHFHGRIFSAYDVQRWKPDPALFLFAAERLGVPPARCAVVEDSLPGVQ 176 Query: 177 AIKSAGMFAVGV 188 A +AGM + + Sbjct: 177 AGLAAGMKVIAL 188 Lambda K H 0.319 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 124 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 226 Length of database: 215 Length adjustment: 22 Effective length of query: 204 Effective length of database: 193 Effective search space: 39372 Effective search space used: 39372 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory