Align mannitol 2-dehydrogenase (EC 1.1.1.67) (characterized)
to candidate HSERO_RS17015 HSERO_RS17015 sulfurtransferase
Query= BRENDA::Q8KQG6 (338 letters) >FitnessBrowser__HerbieS:HSERO_RS17015 Length = 345 Score = 130 bits (326), Expect = 6e-35 Identities = 102/333 (30%), Positives = 159/333 (47%), Gaps = 35/333 (10%) Query: 1 MEALVLTGTKKLEVKDIDRPKVL-PNEVLIHTAFAGICGTDHALYA-GLPGSADAVPPIV 58 M+ALVL T++L++++ID P+ + +V I GICG+D Y G G P+V Sbjct: 1 MQALVLEATRELKLREIDLPQQMGAQDVRIRIHTVGICGSDLHYYTHGSIGPFKVEAPMV 60 Query: 59 LGHENSGVVAEIGSAVTNVKVGDRVTVDPNIYCGQCKYCRTARPELCENLSAVGVTRDGG 118 LGHE SG V E+GSAV+++KVGDRV ++P I P L + G+ Sbjct: 61 LGHEASGTVIEVGSAVSHLKVGDRVCMEPGI------------PRLDSPATLRGMYNLDP 108 Query: 119 FEEFFTAP-------ASVVYP------IPDNVSLKSAAVVEPISCAVHGIQLLKVTPYQK 165 F+ P SVV+P +PDNVS A+VEP+S + ++ P Sbjct: 109 AVRFWATPPIHGCLTGSVVHPAAFTYRLPDNVSFAEGAIVEPLSIGLQAATKARMKPGDT 168 Query: 166 ALVIGDGFMGELFVQILQAYGIHQVDLAGIVDEKLAMNKEKFGV------KNTYNTMKGD 219 A+VIG G +G + A G +V LA +V EKLA + V + T + Sbjct: 169 AVVIGAGTIGAMTALAALAGGAARVILADVVAEKLAHFADNPAVITVDVTRETLTDVVRQ 228 Query: 220 KIPEGEYDVIIEAVGLPQTQEAAIEASARGAQVLMFGVGGPDAKFQMNTYEVFQKQLTIQ 279 DV+ EA G + ++ G ++ VG P A ++ + K++ ++ Sbjct: 229 ATDGWGADVVFEASGHAGVYQTLLDLVCPGGCAVL--VGMPPAPVALDVVAMQTKEVRLE 286 Query: 280 GSFINPNAFEDSLALLSSGKLNVEALMSHELDY 312 F N F +LAL+SSG ++V+ +S + + Sbjct: 287 SVFRYANIFPRALALISSGMIDVKPFISRKFPF 319 Lambda K H 0.317 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 268 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 345 Length adjustment: 29 Effective length of query: 309 Effective length of database: 316 Effective search space: 97644 Effective search space used: 97644 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory