GapMind for catabolism of small carbon sources

 

Aligments for a candidate for HSERO_RS03640 in Herbaspirillum seropedicae SmR1

Align Ribose import ATP-binding protein RbsA; EC 7.5.2.7 (characterized, see rationale)
to candidate HSERO_RS05250 HSERO_RS05250 D-ribose transporter ATP binding protein

Query= uniprot:D8IZC7
         (521 letters)



>lcl|FitnessBrowser__HerbieS:HSERO_RS05250 HSERO_RS05250 D-ribose
           transporter ATP binding protein
          Length = 520

 Score =  434 bits (1117), Expect = e-126
 Identities = 236/499 (47%), Positives = 330/499 (66%), Gaps = 6/499 (1%)

Query: 2   TQTPLLQMRGIRKSFGATLALSDMHLTIRPGEIHALMGENGAGKSTLMKVLSGVHAPDQG 61
           +  P++ +R + K F   LAL +    +  GE+HALMGENGAGKSTLMK+LSGV+  D G
Sbjct: 18  SSVPVIALRNVCKRFPGVLALDNCQFELAAGEVHALMGENGAGKSTLMKILSGVYQRDSG 77

Query: 62  EILLDGRPVALRDPGASRAAGINLIYQELAVAPNISVAANVFMGSELRTRLGL-IDHAAM 120
           +ILLDG+PV + +P  ++A GI +I+QEL +  ++S A N+F+G E R  +GL ID   +
Sbjct: 78  DILLDGKPVEITEPRQAQALGIGIIHQELNLMNHLSAAQNIFIGREPRKAMGLFIDEDEL 137

Query: 121 RSRTDAVLRQLGAGFGASDLAGRLSIAEQQQVEIARALVHRSRIVIMDEPTAALSERETE 180
             +  A+  ++      S   G L++A QQ VEIA+AL   SR++IMDEPTAAL+  E  
Sbjct: 138 NRQAAAIFARMRLDMDPSTPVGELTVARQQMVEIAKALSFDSRVLIMDEPTAALNNAEIA 197

Query: 181 QLFNVVRRLRDEGLAIIYISHRMAEVYALADRVTVLRDGSFVGELVRDEIDSERIVQMMV 240
           +LF ++R L+ +G+ I+YISH+M E+  +ADRV+V+RDG ++  +   E   + I+ MMV
Sbjct: 198 ELFRIIRDLQAQGVGIVYISHKMDELRQIADRVSVMRDGKYIATVPMQETSMDTIISMMV 257

Query: 241 GRSLSEFYQHQRIAPADAAQLPTVMQVRALAGGK-IRPASFDVRAGEVLGFAGLVGAGRT 299
           GR+L      QRI P D ++   V++VR L  G+ IR  SF +R GE+LGFAGL+GAGRT
Sbjct: 258 GRALDG---EQRIPP-DTSRNDVVLEVRGLNRGRAIRDVSFTLRKGEILGFAGLMGAGRT 313

Query: 300 ELARLLFGADPRSGGDILLEGRPVHIDQPRAAMRAGIAYVPEDRKGQGLFLQMAVAANAT 359
           E+AR +FGADP   G+I++ G    I  P  A+  GI Y+ EDRK  GL + M V AN  
Sbjct: 314 EVARAIFGADPLEAGEIIIHGGKAVIKSPADAVAHGIGYLSEDRKHFGLAVGMDVQANIA 373

Query: 360 MNVASRHTRLGLVRSRSLGGVARAAIQRLNVKVAHPETPVGKLSGGNQQKVLLARWLEIA 419
           ++   R TR+G +  R++   A+  +++L +K    E     LSGGNQQK+++A+WL   
Sbjct: 374 LSSMGRFTRVGFMDQRAIREAAQMYVRQLAIKTPSVEQQARLLSGGNQQKIVIAKWLLRD 433

Query: 420 PKVLILDEPTRGVDIYAKSEIYQLVHRLASQGVAVVVISSELPEVIGICDRVLVMREGMI 479
             +L  DEPTRG+D+ AKSEIY+L+  LA QG A+V+ISSELPEV+ +  RVLVM EG I
Sbjct: 434 CDILFFDEPTRGIDVGAKSEIYKLLDALAEQGKAIVMISSELPEVLRMSHRVLVMCEGRI 493

Query: 480 TGELAGAAITQENIMRLAT 498
           TGELA A  TQE IM+LAT
Sbjct: 494 TGELARADATQEKIMQLAT 512



 Score =  111 bits (278), Expect = 6e-29
 Identities = 71/242 (29%), Positives = 126/242 (52%), Gaps = 9/242 (3%)

Query: 6   LLQMRGIRKSFGATLALSDMHLTIRPGEIHALMGENGAGKSTLMKVLSGVHAPDQGEILL 65
           +L++RG+ +      A+ D+  T+R GEI    G  GAG++ + + + G    + GEI++
Sbjct: 277 VLEVRGLNRG----RAIRDVSFTLRKGEILGFAGLMGAGRTEVARAIFGADPLEAGEIII 332

Query: 66  DGRPVALRDPGASRAAGINLIYQE---LAVAPNISVAANVFMGSELR-TRLGLIDHAAMR 121
            G    ++ P  + A GI  + ++     +A  + V AN+ + S  R TR+G +D  A+R
Sbjct: 333 HGGKAVIKSPADAVAHGIGYLSEDRKHFGLAVGMDVQANIALSSMGRFTRVGFMDQRAIR 392

Query: 122 SRTDAVLRQLGAGFGASDLAGRL-SIAEQQQVEIARALVHRSRIVIMDEPTAALSERETE 180
                 +RQL     + +   RL S   QQ++ IA+ L+    I+  DEPT  +      
Sbjct: 393 EAAQMYVRQLAIKTPSVEQQARLLSGGNQQKIVIAKWLLRDCDILFFDEPTRGIDVGAKS 452

Query: 181 QLFNVVRRLRDEGLAIIYISHRMAEVYALADRVTVLRDGSFVGELVRDEIDSERIVQMMV 240
           +++ ++  L ++G AI+ IS  + EV  ++ RV V+ +G   GEL R +   E+I+Q+  
Sbjct: 453 EIYKLLDALAEQGKAIVMISSELPEVLRMSHRVLVMCEGRITGELARADATQEKIMQLAT 512

Query: 241 GR 242
            R
Sbjct: 513 QR 514


Lambda     K      H
   0.320    0.135    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 725
Number of extensions: 33
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 521
Length of database: 520
Length adjustment: 35
Effective length of query: 486
Effective length of database: 485
Effective search space:   235710
Effective search space used:   235710
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory