Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate HSERO_RS05255 HSERO_RS05255 ribose ABC transporter permease
Query= uniprot:D8IZC8 (344 letters) >FitnessBrowser__HerbieS:HSERO_RS05255 Length = 347 Score = 208 bits (530), Expect = 1e-58 Identities = 133/355 (37%), Positives = 196/355 (55%), Gaps = 33/355 (9%) Query: 2 ADTKMTHTHDAVPPGARRSSSTTAQWLLHRLGMLPVLVVLYLLFYGLTLYLSGDGTSNFA 61 A T M +T A AR + Q LL +L L++L+ F + NF Sbjct: 11 ASTTMANTASAQGLRARLFNPAARQKLLAFASLL--LMILFFSF----------ASPNFM 58 Query: 62 SAENTMNILRQVAINLVLAAGMTFVILTAGIDLSVGSVLAVSAVL--------GMQVSLG 113 +N ++IL+ A+N VLA T+VI+T+GIDLSVG+++ AV+ GM + LG Sbjct: 59 EVDNLVSILQSTAVNGVLAIACTYVIITSGIDLSVGTMMTFCAVMAGVVLTNWGMPLPLG 118 Query: 114 AAPGWAIPMFIFSGLVMGMVNGAMVALLNINAFVVTLGTMTAFRGAAYLLADGTTVLNND 173 A IF G + G ++G ++A L + F+ TLG M +G + +++ + ND Sbjct: 119 IAAA------IFFGALSGWISGMVIAKLKVPPFIATLGMMMLLKGLSLVISGTRPIYFND 172 Query: 174 IPSFEWIGN----GDF---LHVPWLIWVAVAVVLLSWVILRKTVLGMHIYAIGGNLQAAR 226 F I GD L +P + + V + + +IL KTV G + +A+G N +A R Sbjct: 173 TEGFSAIAQDSLIGDLIPSLPIPNAVLILFLVAIGASIILNKTVFGRYTFALGSNEEALR 232 Query: 227 LTGIRVGLVLLFVYSISGLFSGLAGAMSASRLYGANGNWGSGYELDAIAAVVLGGTSLMG 286 L+G++V + VY+ SG G+AG + ASRL A G GYELDAIAAVV+GGTSL G Sbjct: 233 LSGVKVDFWKVAVYTFSGAICGIAGLIIASRLNSAQPALGQGYELDAIAAVVIGGTSLSG 292 Query: 287 GVGSIWGTVVGALIIGVMNNGLTILGLSSFWQYVAKGAVIVLAVILDKWRQKDAA 341 G G+I GT++GA I+ V+ NGL I+ ++ WQ V G +I+LAV LD R++ A Sbjct: 293 GTGTILGTIIGAFIMSVLVNGLRIMSVAQEWQTVVTGVIIILAVYLDILRRRRRA 347 Lambda K H 0.324 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 331 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 347 Length adjustment: 29 Effective length of query: 315 Effective length of database: 318 Effective search space: 100170 Effective search space used: 100170 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory