Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate HSERO_RS05325 HSERO_RS05325 ribose ABC transporter permease
Query= uniprot:D8IZC8 (344 letters) >FitnessBrowser__HerbieS:HSERO_RS05325 Length = 328 Score = 225 bits (573), Expect = 1e-63 Identities = 135/336 (40%), Positives = 206/336 (61%), Gaps = 19/336 (5%) Query: 10 HDA-VPPGARRSSSTTAQW--LLHRLGMLPV--LVVLYLLFYGLTLYLSGDGTSNFASAE 64 HDA P A ++ +A+W L+H LP+ LVV+ LL G + NF + Sbjct: 3 HDANALPAASLHTAASARWRSLIHSPLALPLAGLVVVSLLM--------GLASDNFFTLS 54 Query: 65 NTMNILRQVAINLVLAAGMTFVILTAGIDLSVGSVLAVSAVL--GMQVSLGAAPGWAIPM 122 N N+LRQV+I +LA GM+FVILT GIDLSVG+ +A++ + G+ V+ G A+ Sbjct: 55 NWFNVLRQVSIVGILAVGMSFVILTGGIDLSVGAAMALAGTISAGLIVNSGLPAPLALLC 114 Query: 123 FIFSGLVMGMVNGAMVALLNINAFVVTLGTMTAFRGAAYLLADGTTVLNNDIPSF-EWIG 181 + +G++NGA+VA + A +VTL TM RG + + G + + +P + W G Sbjct: 115 GVGLATCIGLLNGALVAWGRMPAIIVTLATMGVARGVGLIYSGGYPI--SGLPGWISWFG 172 Query: 182 NGDFLHVPWLIWVAVAVVLLSWVILRKTVLGMHIYAIGGNLQAARLTGIRVGLVLLFVYS 241 G VP + + + V L+W++L++T G H+YAIGGN AARL+G++ + L VY+ Sbjct: 173 VGRIGMVPVPVILMLIVYALAWLLLQRTAFGRHVYAIGGNEMAARLSGVKTTRIKLAVYA 232 Query: 242 ISGLFSGLAGAMSASRLYGANGNWGSGYELDAIAAVVLGGTSLMGGVGSIWGTVVGALII 301 ISG SGLA + RL N G G+ELDAIAAVVLGGT++ GG G + GT++GA+++ Sbjct: 233 ISGFTSGLAAIILTGRLMSGQPNAGVGFELDAIAAVVLGGTAIAGGRGLVVGTLIGAVLL 292 Query: 302 GVMNNGLTILGLSSFWQYVAKGAVIVLAV-ILDKWR 336 G++NNGL ++G++ + Q + +G +I+LA+ I +WR Sbjct: 293 GILNNGLNLMGINPYLQDIIRGVIILLAIYIAREWR 328 Lambda K H 0.324 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 381 Number of extensions: 30 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 328 Length adjustment: 28 Effective length of query: 316 Effective length of database: 300 Effective search space: 94800 Effective search space used: 94800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory